KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1643Help
Entry
lpg1643           CDS       T00199                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
lpn00260  Glycine, serine and threonine metabolism
lpn00750  Vitamin B6 metabolism
lpn01100  Metabolic pathways
lpn01110  Biosynthesis of secondary metabolites
lpn01120  Microbial metabolism in diverse environments
lpn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpg1643 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lpg1643 (thrC)
Enzymes [BR:lpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lpg1643 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Ntox44 HBS1_N
Motif
Other DBs
NCBI-GeneID: 19833208
NCBI-ProteinID: YP_095670
Pasteur: lpg1643
UniProt: Q5ZUZ9
Position
complement(1816951..1818219)
Genome map
AA seq 422 aa AA seqDB search
MKIRIKSTRGQCVSTIDEAILSGLAGDGGLFVPDRFPNLTIKKFYEYGNLIDFSVNLLSP
FFSDSKIDVNNAFFQKFLTFSFPLHHLFKKSYVLELFHGPTLSFKDLGTQFFSECLLHLI
ENKSAKVLVATSGDTGAAIAHALDGKRDLEGIILFPKDKLTFRQQSQITCWGENIRALAV
NGSFDQCQQLVKLVFAKREHKGILTTANSMNIARLLPQIIFYAFTSIQLALRHNHSVNFI
VPGGNLGNVTACYWAKMLGFPVEQILIANNINSALGEFLLTGAYQAKSVTKTLATAMDVG
EPSNLDRLFVLFNNYSECKKQMNAESVSDEQIKQAILHCYNKYHYIICPHTATAYHRLST
INQDKPWVIVAPGHPAKFEEVLEPLLKKEIPVPEQLKVLLGRKQHYSIIEPNYHALYHFL
VE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaataaagagtacgagaggacaatgtgtctccacaatagacgaagcgata
ctgtcaggcctggcaggggatggtgggttatttgtacctgacaggtttcccaatttaaca
ataaaaaaattttatgaatacggtaatttaatcgacttttctgttaatttactctcgcca
tttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctcaccttc
tcctttccgttacatcatctttttaagaaaagttatgtactggagttgtttcatggccca
accctgtcttttaaagatttaggaactcaatttttcagtgaatgtttattgcatctgata
gaaaacaagagcgccaaagttctggtcgcaacatctggtgatactggcgctgcgattgct
catgctttggatgggaaaagagatctggaaggaatcattttatttcctaaagataaactt
actttcagacaacaatctcaaattacttgttggggagagaatattcgtgcattggctgtt
aatggcagttttgatcaatgtcaacagctggtgaagctggtatttgccaaaagagaacat
aaaggaatattgactacagccaatagcatgaatatagccagattattaccacagattatt
ttctatgcttttaccagcattcaattggcattaagacataatcattctgttaattttata
gttccaggcggaaacctggggaatgttacggcttgttattgggcaaaaatgctgggtttt
ccggttgagcaaattttaatagctaataatattaatagtgcactgggcgaatttttgtta
actggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggatgtaggt
gagccaagcaatttggaccgcttattcgttttatttaataattattctgaatgtaaaaaa
cagatgaatgcagaatctgttagtgatgagcaaattaagcaagctatcctacattgttac
aataaatatcattatataatttgccctcataccgccacagcttatcatcgtctaagtaca
atcaatcaggacaaaccctgggttattgtggcaccagggcacccggccaaatttgaagag
gtattagaaccactattgaaaaaagaaattcctgtcccggaacagctgaaggtcctttta
ggcagaaaacaacattattcaatcatagagccaaactatcatgctttgtatcatttctta
gttgaatga

DBGET integrated database retrieval system