KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1643Help
Entry
lpg1643           CDS       T00199                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpg1643 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lpg1643 (thrC)
Enzymes [BR:lpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lpg1643 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(1816951..1818219)
Genome map
AA seq 422 aa AA seqDB search
MKIRIKSTRGQCVSTIDEAILSGLAGDGGLFVPDRFPNLTIKKFYEYGNLIDFSVNLLSP
FFSDSKIDVNNAFFQKFLTFSFPLHHLFKKSYVLELFHGPTLSFKDLGTQFFSECLLHLI
ENKSAKVLVATSGDTGAAIAHALDGKRDLEGIILFPKDKLTFRQQSQITCWGENIRALAV
NGSFDQCQQLVKLVFAKREHKGILTTANSMNIARLLPQIIFYAFTSIQLALRHNHSVNFI
VPGGNLGNVTACYWAKMLGFPVEQILIANNINSALGEFLLTGAYQAKSVTKTLATAMDVG
EPSNLDRLFVLFNNYSECKKQMNAESVSDEQIKQAILHCYNKYHYIICPHTATAYHRLST
INQDKPWVIVAPGHPAKFEEVLEPLLKKEIPVPEQLKVLLGRKQHYSIIEPNYHALYHFL
VE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaataaagagtacgagaggacaatgtgtctccacaatagacgaagcgata
ctgtcaggcctggcaggggatggtgggttatttgtacctgacaggtttcccaatttaaca
ataaaaaaattttatgaatacggtaatttaatcgacttttctgttaatttactctcgcca
tttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctcaccttc
tcctttccgttacatcatctttttaagaaaagttatgtactggagttgtttcatggccca
accctgtcttttaaagatttaggaactcaatttttcagtgaatgtttattgcatctgata
gaaaacaagagcgccaaagttctggtcgcaacatctggtgatactggcgctgcgattgct
catgctttggatgggaaaagagatctggaaggaatcattttatttcctaaagataaactt
actttcagacaacaatctcaaattacttgttggggagagaatattcgtgcattggctgtt
aatggcagttttgatcaatgtcaacagctggtgaagctggtatttgccaaaagagaacat
aaaggaatattgactacagccaatagcatgaatatagccagattattaccacagattatt
ttctatgcttttaccagcattcaattggcattaagacataatcattctgttaattttata
gttccaggcggaaacctggggaatgttacggcttgttattgggcaaaaatgctgggtttt
ccggttgagcaaattttaatagctaataatattaatagtgcactgggcgaatttttgtta
actggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggatgtaggt
gagccaagcaatttggaccgcttattcgttttatttaataattattctgaatgtaaaaaa
cagatgaatgcagaatctgttagtgatgagcaaattaagcaagctatcctacattgttac
aataaatatcattatataatttgccctcataccgccacagcttatcatcgtctaagtaca
atcaatcaggacaaaccctgggttattgtggcaccagggcacccggccaaatttgaagag
gtattagaaccactattgaaaaaagaaattcctgtcccggaacagctgaaggtcctttta
ggcagaaaacaacattattcaatcatagagccaaactatcatgctttgtatcatttctta
gttgaatga

DBGET integrated database retrieval system