KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg2316Help
Entry
lpg2316           CDS       T00199                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:lpn00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:lpn00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2617896..2618678
Genome map
AA seq 260 aa AA seqDB search
MKLKNKVAIVTGAASGIGKEIALVYAKEGAKVAIADLNLDQASHVAEEIKSSGGQAMAVA
MNVTDEAQVNQGVDKVADHFGGVDVLVSNAGIQIIESVDKLAFSDWKRMLAIHLDGAFLT
TKACLKYMYASGNGGSIIYMGSVHSKEASVLKAPYVTAKHGLLGLCKVVAKEGGTHKVRA
NVICPGFVRTPLVDKQIPEQAKELGISEEDVIKKVMLKETVDGEFTTTDDVAQTALFFAS
FESNALTGQSLVVSHGWFME
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaagaataaagtcgctattgttacaggagcagcaagcggaattggtaaagaa
attgcgcttgtttatgctaaagaaggggcaaaggtagcaatcgctgatctgaatcttgat
caggcaagccatgtagcagaggaaatcaaatcatcaggcggacaagcaatggccgttgcc
atgaatgtaactgatgaagcacaagtcaatcagggcgtggataaagtagccgatcacttt
ggaggggttgatgttttagtcagcaatgccggtattcaaatcatcgaatcagtggataaa
ttagccttttcagactggaaaagaatgcttgccattcatttggatggtgcctttttaact
actaaagcttgcttgaaatacatgtatgcctcaggcaatggcggcagtattatttatatg
ggctcggtccattccaaagaagcttctgtactcaaagcaccttatgttactgccaaacat
ggtctattgggtttatgcaaagtagttgccaaggaaggtggaactcataaggtaagagcc
aatgtcatttgcccggggtttgtccgtactcctctcgttgacaaacaaattccagagcaa
gcaaaagaattaggcatcagtgaagaagatgtcatcaagaaagtgatgctaaaagaaaca
gttgacggggaattcaccaccacagacgatgtagcacaaaccgctttattttttgcatca
tttgaatcgaatgcgcttacaggacaatcattggtagtcagtcatggttggttcatggag
taa

DBGET integrated database retrieval system