KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg2316Help
Entry
lpg2316           CDS       T00199                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    lpg2316 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    lpg2316 (bdhA)
Enzymes [BR:lpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     lpg2316 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2617896..2618678
Genome map
AA seq 260 aa AA seqDB search
MKLKNKVAIVTGAASGIGKEIALVYAKEGAKVAIADLNLDQASHVAEEIKSSGGQAMAVA
MNVTDEAQVNQGVDKVADHFGGVDVLVSNAGIQIIESVDKLAFSDWKRMLAIHLDGAFLT
TKACLKYMYASGNGGSIIYMGSVHSKEASVLKAPYVTAKHGLLGLCKVVAKEGGTHKVRA
NVICPGFVRTPLVDKQIPEQAKELGISEEDVIKKVMLKETVDGEFTTTDDVAQTALFFAS
FESNALTGQSLVVSHGWFME
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaagaataaagtcgctattgttacaggagcagcaagcggaattggtaaagaa
attgcgcttgtttatgctaaagaaggggcaaaggtagcaatcgctgatctgaatcttgat
caggcaagccatgtagcagaggaaatcaaatcatcaggcggacaagcaatggccgttgcc
atgaatgtaactgatgaagcacaagtcaatcagggcgtggataaagtagccgatcacttt
ggaggggttgatgttttagtcagcaatgccggtattcaaatcatcgaatcagtggataaa
ttagccttttcagactggaaaagaatgcttgccattcatttggatggtgcctttttaact
actaaagcttgcttgaaatacatgtatgcctcaggcaatggcggcagtattatttatatg
ggctcggtccattccaaagaagcttctgtactcaaagcaccttatgttactgccaaacat
ggtctattgggtttatgcaaagtagttgccaaggaaggtggaactcataaggtaagagcc
aatgtcatttgcccggggtttgtccgtactcctctcgttgacaaacaaattccagagcaa
gcaaaagaattaggcatcagtgaagaagatgtcatcaagaaagtgatgctaaaagaaaca
gttgacggggaattcaccaccacagacgatgtagcacaaaccgctttattttttgcatca
tttgaatcgaatgcgcttacaggacaatcattggtagtcagtcatggttggttcatggag
taa

DBGET integrated database retrieval system