KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg2632Help
Entry
lpg2632           CDS       T00199                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lpg2632 (holC)
   00240 Pyrimidine metabolism
    lpg2632 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    lpg2632 (holC)
   03430 Mismatch repair
    lpg2632 (holC)
   03440 Homologous recombination
    lpg2632 (holC)
Enzymes [BR:lpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     lpg2632 (holC)
DNA replication proteins [BR:lpn03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     lpg2632 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2973928..2974362
Genome map
AA seq 144 aa AA seqDB search
MSPIRVDFYLLASSLPESRWLVACRLIEKAYTKGHTIFVFCDNQQQAEYLDELLWTFKDD
SFIPHNLQGEGPEPPPPVQIGYQKEPRGFTDILLNLSTNIPIFYTRFKRVIELVSNVEHE
KEVSRLHYKEYRHKGCELHTHSIE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaattcgcgttgatttttacttattagccagcagccttccagaatctcgctgg
ttggttgcttgtcgtttaatagaaaaagcctataccaaaggacatactatttttgttttt
tgcgacaatcagcaacaagcagaataccttgatgaattattatggactttcaaagacgac
agttttattcctcataatttgcaaggtgaaggaccggagcctcctcctcccgtacaaatt
ggctatcaaaaagaacccagaggctttacagatatcctgttgaatttatccaccaatatt
ccaattttttatacccgatttaaaagagtcattgaattggtgagtaatgtagaacatgag
aaagaagtgagtcgattgcactataaagaatataggcataaaggctgtgagctgcacaca
cactccattgaataa

DBGET integrated database retrieval system