KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg2736Help
Entry
lpg2736           CDS       T00199                                 

Definition
uroporphyrinogen III methylase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    lpg2736
Enzymes [BR:lpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     lpg2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3086607..3087359
Genome map
AA seq 250 aa AA seqDB search
MTKSLNGLRILNTRPREQAQVLNKKIIESGGIPIDCPTMEIMASETNWINNLPDLTSVNQ
AIFVSTNAVRYFMMELASKNINWPNSIRVTAIGKGTSRVLNEFNIQVSDVPELPDSEHLL
TLNSLQQIRNQTILLVKGEGGRQLIEEYLMLKGAKLCLLSVYKRVMPAIDQEFINSLWRD
DLVDIILLTSEQSIHNLFKMFSIEGQMWLQNKPCLVISDRLAKVASLFGIKKILISHPER
MIGALFDYKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatcacttaatggtcttcgcatattaaacaccagacccagggagcaagcacaa
gtgcttaataaaaaaattatcgagtctggcggaatacccatcgactgccccacgatggaa
ataatggcgtctgaaaccaattggataaataatttgcctgatttgacctcagtaaatcag
gccatttttgtcagtacaaatgccgttcgttatttcatgatggaactggcttccaaaaac
atcaattggccaaatagcatccgggtaactgctataggtaaaggcacctccagagtactc
aatgaattcaatatccaggttagtgatgtccccgaattacctgacagcgagcatttactg
actctcaattcgttgcaacaaataagaaatcagacgattctgcttgtgaaaggagaagga
ggcaggcaactgattgaagaatatttaatgctgaagggagcgaaactatgtcttctgtca
gtctataaacgagtcatgccagccatcgaccaagaatttattaattctctgtggcgcgat
gacctggtggacattatactgttaacaagtgagcagtccatacataatctttttaaaatg
tttagcatagaggggcaaatgtggttacaaaacaaaccttgcctggtcattagtgaccga
cttgcaaaggtagcttctttatttggaattaaaaagattcttattagccatccagaaagg
atgataggtgcgttatttgactataaggattaa

DBGET integrated database retrieval system