KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg2756Help
Entry
lpg2756           CDS       T00199                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lpn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3105451..3106050
Genome map
AA seq 199 aa AA seqDB search
MTMDALSRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMKHISHCQQCN
NYTEQTLCALCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLDGLGPDD
IGLPKLKELITREKIQEVILALSPSVESQTTIHFIHQLLKDETVNISQLAHGIPSGGELE
FLDGNTISSALKNRAVINV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ctgactatggatgctctaagccgattggtagaggcgcttcgctgtcttcccggtgtggga
ccaaaatcagcacaaaggatggtgttccatttattgcagcaccaaaggcagcgaggttta
caccttgcctcctgtttagaacaggcaatgaagcacattagtcattgtcagcagtgtaat
aattacaccgaacaaacactgtgtgctctttgtcaaaatcctaatcgagattcgacattg
ctttgtgtggtagagagtccagcagatgtttctgccatagaacaaagcaattcctttcaa
ggtaagtattttgtccttatgggaaaaatttctcctcttgatggcttgggacctgatgac
ataggtctaccgaaacttaaggagttaattactagggaaaaaattcaggaagttattctt
gcattaagccccagtgttgaaagccagaccacaattcattttattcatcagttgctaaag
gatgaaaccgtcaatatcagtcagttagcacatggaataccatcaggtggtgaattagaa
tttttagatgggaatactataagcagtgcccttaagaacagagctgtgattaatgtctaa

DBGET integrated database retrieval system