KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg2756Help
Entry
lpg2756           CDS       T00199                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpg2756 (recR)
DNA repair and recombination proteins [BR:lpn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      lpg2756 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3105451..3106050
Genome map
AA seq 199 aa AA seqDB search
MTMDALSRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMKHISHCQQCN
NYTEQTLCALCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLDGLGPDD
IGLPKLKELITREKIQEVILALSPSVESQTTIHFIHQLLKDETVNISQLAHGIPSGGELE
FLDGNTISSALKNRAVINV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ctgactatggatgctctaagccgattggtagaggcgcttcgctgtcttcccggtgtggga
ccaaaatcagcacaaaggatggtgttccatttattgcagcaccaaaggcagcgaggttta
caccttgcctcctgtttagaacaggcaatgaagcacattagtcattgtcagcagtgtaat
aattacaccgaacaaacactgtgtgctctttgtcaaaatcctaatcgagattcgacattg
ctttgtgtggtagagagtccagcagatgtttctgccatagaacaaagcaattcctttcaa
ggtaagtattttgtccttatgggaaaaatttctcctcttgatggcttgggacctgatgac
ataggtctaccgaaacttaaggagttaattactagggaaaaaattcaggaagttattctt
gcattaagccccagtgttgaaagccagaccacaattcattttattcatcagttgctaaag
gatgaaaccgtcaatatcagtcagttagcacatggaataccatcaggtggtgaattagaa
tttttagatgggaatactataagcagtgcccttaagaacagagctgtgattaatgtctaa

DBGET integrated database retrieval system