KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg2845Help
Entry
lpg2845           CDS       T00199                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Brite
Enzymes [BR:lpn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     lpg2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3220404..3221213
Genome map
AA seq 269 aa AA seqDB search
MTMKNEYSMKINDFRYMRRGKHLSELQSEEANLLAPVNQRGKGTERALLVLHGFSSSPAV
YRYLIPNLKNYDAILCPVLAGHAESIEAFSKSKAADWLQSAKSACELLINQYQKVDVLGL
SLGGLLACQLSQSYAINHLFLLAPALKLHMRINAMLKLAQILKCLGFRQLRNAAGNIITD
EHAEIAYRKLPISTIIEMLTLAQGYEWLPPTCPADLFLGIHDQVVASQQVEQLFCNLPNV
KIHWLKNSAHVLPLDNDLNEIIDCINKSK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaaaaatgaatattctatgaaaatcaatgattttcggtatatgcgccgcggc
aaacatctcagcgaactgcagtcggaggaagcaaatctccttgctccagtcaatcagcgt
ggtaaaggcacagaacgagctttactggtattgcatggtttctcttcttcaccggcagtt
taccgatatctgattcctaatttaaaaaattatgatgccatcctttgtcctgtattggct
ggtcacgccgaaagtatagaagccttttcaaaatccaaagcagctgattggcttcaatca
gcaaaaagcgcctgtgaactcttaataaatcagtatcaaaaagttgatgttttaggatta
tccctgggaggattattagcctgtcaattaagtcaatcctatgctatcaatcacctgttt
ctattagcccccgcattaaaattacacatgcgcatcaacgccatgctgaaattagcccag
attcttaagtgcctcggatttcgacaacttcgcaacgctgcagggaatattatcaccgat
gagcatgccgaaatcgcttatagaaaacttcccatttccacaatcattgaaatgctaacc
ttggctcagggatatgaatggctccccccaacttgcccggccgatctttttcttggaatt
catgatcaagtggttgcttctcaacaagtagaacaattattttgtaatttacctaatgtc
aaaatacattggctaaaaaattccgcgcatgtactgccgctagacaacgatctgaatgag
attattgattgtattaataaaagcaaatga

DBGET integrated database retrieval system