KEGG   Legionella pneumophila subsp. pneumophila Lorraine: LPO_0607Help
Entry
LPO_0607          CDS       T02175                                 

Gene name
sucA
Definition
2-oxoglutarate decarboxylase (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LPO_0607 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LPO_0607 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    LPO_0607 (sucA)
   00380 Tryptophan metabolism
    LPO_0607 (sucA)
Enzymes [BR:lpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     LPO_0607 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
595223..598033
Genome map
AA seq 936 aa AA seqDB search
MSSSDLQKEWASSYLSGGSMAYVDSLYEDYLADPDSVSEDWRAVFSALPKVNGATKEVSH
RDIRDYFLQNADKKLNKIIQIADSQQYQVASLINDFRSLGHLAAKLDPLEMTERMPVPRL
ELAYHNLADVDVNRTFFAGTSFNGPEMTLGEIYNALRETYCRSIGIEYMHISDTEVTEWL
QHKMESVRGCPEFSKQEKLNILKDLIAADGLERYLGTRYVGQKRFSLEGGDSLIPMMKEL
IRRSGVNQVKELVIGMAHRGRLNVLVNVLGKEPGLLFQEFEGKIKYERTGDVKYHLGFSS
DIKTESGAIVHLALAFNPSHLEIIGPVVEGSVRSRLGRRNDLAKKDKVVPIVIHGDAAFA
GQGVVMETFNFSQARGYCTGGTIHIVINNQIGFTTSNPLDARSTLYCTDVAKMVQAPVIH
VNGDDPEAVVFATQVAFDFRMKFKRDIVIDLVCYRRHGHNEADEPSVTQPKMYKKIKSMP
TLREKYGEQLVSVNLLTKTELDKLVDSYREALDKGKAVVDLVHEDYEGKQSLDWTPYINA
KWTDKVDTTISKEELEKISSQLNKLPDGMKLHPVVERLLAERNKMTAGEIPMNWGYAEIM
AYASLLHEGYGVRISGQDSGRGTFAHRHAALHDIEKGDTFIPLEHISTNPKRYFTVIDSV
LSEEAVLAFEYGFASSEPSFLVIWEAQFGDFANGAQVVIDQFISSGEQKWGRLCGLVMLL
PHGYEGQGPEHSSARLERYMQLCAQHNIQVCTPTTPAQIFHLLRRQVIRNFRKPLIVMTP
KSLLRHKLAVSPLEALFKGKFHTVIPEIDALDAQKVTKVVLCCGKVYYDLLQMRRDKNLN
HVAIVRIEQLYPFPKKALMAELEKYQKANEVVWCQEEPQNQGVWFSSQHNIRDCLRSDQT
LQYAGREFAAAPAVGSPGLHAEQQVALVEQALLGKK
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgagcagttctgatctgcaaaaagaatgggcttcttcctatttgtctggaggaagtatg
gcttatgttgatagtctttatgaggattacctcgcagaccctgattcagtgtcagaggat
tggagagcggtatttagcgctttacccaaagtaaatggtgctaccaaagaagtatctcat
agagacattcgcgattattttttgcagaatgctgacaagaagcttaataaaataattcaa
attgcagatagtcaacagtaccaggttgccagtttgattaatgattttagatcattaggg
catcttgccgcaaaactggatccattggaaatgacggaacgcatgccagtaccgcggctg
gagcttgcttatcataatcttgccgatgttgatgttaatcgcactttttttgctggtacc
agttttaatgggccggagatgactttgggggaaatatacaacgcccttcgcgaaacatac
tgtcgcagtataggcattgagtatatgcatatatccgatactgaagtcactgaatggtta
caacataagatggaatcagttcgtggctgtcctgaatttagtaagcaggaaaaattgaat
atccttaaagatttgatagcagcagacggtttggagcgttatctaggaacccgatatgtt
ggtcaaaaacgattttcgcttgaggggggagattctttaattccaatgatgaaagaactc
attagaagatctggtgtaaatcaggttaaagagcttgtcattggaatggcacatagaggg
cgcttaaatgtgttagtgaatgttctcggtaaagaaccaggactattatttcaagaattt
gaaggaaaaattaaatacgaacgaactggcgatgtgaagtatcatctgggtttttcctct
gacataaaaacagaatcaggtgctattgtgcacctggctttggcgtttaacccttcacac
ttggaaattattgggccagtagttgagggatccgtacgttcacgtttgggaagacgcaac
gatttggctaaaaaagataaagtagttcccattgtcattcatggtgatgctgcttttgca
ggtcagggcgtggttatggaaacctttaacttctcccaggcacgtggttattgtactggt
ggaacgatccatattgttatcaataatcagataggatttacaacgagcaatcctttggat
gcccgttcaactctctattgtacagacgttgccaaaatggttcaggcgccagttattcat
gtcaatggtgatgatcctgaggcagtagttttcgctactcaagttgcctttgatttccgc
atgaagtttaaacgagacatagtaattgaccttgtctgttacagacgtcatggccacaac
gaagctgatgaaccttcagtgacccagccaaagatgtataaaaaaatcaaatccatgcct
acattacgtgaaaaatatggagaacaattggtcagtgttaatttattaactaaaacagaa
ttagacaaattggtcgattcctacagagaagcactagataaaggcaaggcggttgtcgat
ttggttcatgaagattatgaaggaaagcaatctttagattggactccttatataaatgcc
aagtggacggataaagtagacacaaccattagtaaggaagagttggaaaaaatttcatcc
caattaaacaaattgcctgatggaatgaaactgcatcccgttgtggagcgtttgttagct
gaacgaaataaaatgaccgctggtgaaatccctatgaattggggttatgctgagatcatg
gcttatgccagcttattgcatgaaggctatggcgtaagaatttctggacaagatagtggt
cgaggaacttttgcccatagacatgctgcactccatgatattgaaaaaggagatactttt
attcctttggaacatatatcaaccaatcccaagcgctattttaccgtgatagattcagtt
ctttccgaagaagcggtattggctttcgaatatggctttgcttcgtctgagccatctttc
ctggttatttgggaagctcaatttggtgattttgcaaatggagcacaagtcgttatcgat
caatttataagttccggtgagcaaaagtgggggcggctgtgcggattggtgatgctatta
ccccatggctatgaaggacaaggccctgagcactcttctgcgcgattggagcgttatatg
cagctttgtgcacagcacaatattcaagtatgcactccaacaactccagcacaaatattt
catttgttgagaagacaagttattcgtaatttcaggaagcctttaattgtcatgactccc
aaaagtcttttacgacataaattggctgtttcacccttggaagctttgtttaaaggaaag
tttcatacagtaattccggaaatcgatgccttggacgcacaaaaagtaacaaaggtggtg
ctatgctgtggtaaggtttattatgatttattgcaaatgcgtcgcgataaaaacttaaac
cacgtagcgattgtccgtatagagcaattgtatccatttcccaaaaaagcattaatggct
gaattggagaaataccaaaaggctaatgaagttgtctggtgtcaggaagagccacaaaac
caaggagtctggttctcttctcagcataatatacgtgattgcttgcgttctgaccaaacc
ttgcaatatgctggcagagagtttgcagctgcacctgcagttggtagtcccgggttgcat
gcggagcaacaagttgctttggttgagcaagcattacttggtaaaaaataa

DBGET integrated database retrieval system