KEGG   Legionella pneumophila subsp. pneumophila Lorraine: LPO_0714Help
Entry
LPO_0714          CDS       T02175                                 

Gene name
tdk
Definition
thymidine kinase/deoxyuridine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPO_0714 (tdk)
Enzymes [BR:lpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LPO_0714 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
699497..700126
Genome map
AA seq 209 aa AA seqDB search
MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQYGTICSRIGLSEQAY
AFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEITDQMSIPVLAYGLRTD
FRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQAVVEGEQVLIGGNESYV
ATCRLHYKRGEAEVTFPRNKLFNKDTNTF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattatatttctactatgcggctatgaatgcaggtaaaagtacggtgttactg
cagtccagttataattacagagaacgcggtatgcaaactctgttgtttaccccagccatc
gatacacgtttccaatatggaactatctgttcacgtatcggtttatccgaacaggcttat
gcttttaacaattcggataacctgtatgttttaactcaagaatttcaactacaaactcag
aaatactcttgtgtcctgattgacgaggctcaatttttaactcgagagcaagtgtatcaa
ttaacggaaataactgatcaaatgtctatcccagtactagcttatgggttgcgcactgac
tttagaggcgagttatttccgggaagtcaatttttactggcatgggcagatgagttaatc
gaattaaagacaatttgtcattgtggccgtaaagcaattatgaatatgagaattgatgaa
aatgggcaagctgttgttgaaggtgagcaggtattgataggcggcaatgaatcctatgtt
gctacctgtcggttgcattataaacgaggtgaagcagaggtgacatttccaagaaataaa
ttgttcaataaagataccaatactttttaa

DBGET integrated database retrieval system