KEGG   Legionella pneumophila subsp. pneumophila Lorraine: LPO_1627Help
Entry
LPO_1627          CDS       T02175                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine
Pathway
lpo00330  Arginine and proline metabolism
lpo00332  Carbapenem biosynthesis
lpo01100  Metabolic pathways
lpo01130  Biosynthesis of antibiotics
lpo01230  Biosynthesis of amino acids
Module
lpo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lpo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LPO_1627 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LPO_1627 (proB)
Enzymes [BR:lpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LPO_1627 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CCD05657
Position
complement(1669154..1670224)
Genome map
AA seq 356 aa AA seqDB search
MKIIIKVGTQSILSVDGSPIYSVLNNLVNQIIYLKNLGHQVILVSSGAVGSGRKIAKNSL
GKTYGDTVGEKQLLASIGQPELMNLYSRLFKNENILVSQLLLTKQDFHTRQHYLNIARLL
TELLKHQNIIPIVNENDSVAIEELMFTDNDELAGLIAAQINADYLILLTNVDGVFTSHPN
DPESKLINTIDPNSGWPNVSAVKSKLGRGGMVSKLDTARKMAGLGINTVIANVNVESIVP
KILNREAVGTIILASKRKSSIKRWIAFNHRTSLPSIVINDNLITLLRNGNRVMSILPIGI
EGFRGECKKGDLIDILNSNNEKIGVGIARYDFLRLKDYLRLQNKPAFIHYDQLHIL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattataaaagtcggaacacaaagtattttatctgtcgatggaagcccaatc
tattccgtactaaataatcttgtaaatcaaattatctatttaaagaacctggggcatcag
gtcattttagtaagctctggggctgttggctctggtcgaaaaatagctaagaactctctg
ggaaaaacatatggcgatacagtgggagagaagcaactcttggcttcaataggccaaccc
gaactgatgaatctctattctagattgtttaaaaatgaaaacattttagtatctcagtta
ttacttaccaagcaagacttccatactagacagcattatttaaacattgcccgtttatta
acggaattgctaaagcatcaaaatattatccctattgttaatgaaaatgattcggtagcc
attgaagaattaatgtttaccgataatgatgaattagcaggacttattgcagctcaaatt
aatgctgattatctaatactcttaaccaatgtcgatggtgtgtttacatcccatcccaat
gatcctgaatcaaaactcattaatacaattgaccccaattcaggttggcccaatgtctcc
gctgtaaaatcaaaattaggccgaggtggtatggtatccaaactggatactgccagaaaa
atggctggtttaggtatcaatacagtgatcgcaaatgtaaatgtagaatccattgttcca
aaaattctaaatagggaagcagttggaactataattcttgctagtaaaagaaaatccagt
ataaaaagatggattgcttttaatcatagaacttccttaccatctatagtaattaatgat
aatttaattaccttattacgaaatggtaatcgtgtaatgagcattttaccaatagggata
gaaggttttcgtggagaatgcaaaaaaggggatttaattgatatccttaattccaataat
gaaaagataggagttggaatcgctaggtatgatttcttaagattaaaggactatcttaga
cttcaaaataagcctgcatttatacattacgatcaattgcatattctatag

DBGET integrated database retrieval system