KEGG   Legionella pneumophila subsp. pneumophila Lorraine: LPO_1709Help
Entry
LPO_1709          CDS       T02175                                 

Definition
Alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LPO_1709
Enzymes [BR:lpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LPO_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1758616..1760841)
Genome map
AA seq 741 aa AA seqDB search
MAESKLEIVNKTEREESVILDGNGILRCYNMFPTQFGSIEEMIEYLPQLQAMGFNAVWIN
PVQTAGDVQGLFKRDKTIGVRAYNEVTRSLYAMTDCDLISPYFNPLPPNVDPKLKKQLDM
DVMQKFTSEARNNGLVPMFDLVLNHVAADSRHRKEHPEWFQKDVHPDFKDAIAFDYSDPQ
IRDEIIEQFWKPYIYKYMIDYGFEGVRIDAVGYLNPELRKQIYAYIYDLAEQFNKPKPVI
LDELLFSGSQKLTDVVDGLLLPEKGPTHITRGTYYAQRDGYGGLPGWCKEEEGVKAQVVF
LDKQKKLHPHAKGGCIAFSGNHDHNSLAMTILEEMAEHRLANHHTLHGAQEKFKHERSYD
YDEALESVLRYSFVKDIQNEILSGNESTIKEVETRMREKIAFCALTSSGGWYALSGDETG
DLLAKPVFRRVHALDQTYYAQRTHIIFDKKYPDNKVAMEVLTEMAIENIQKEKAGSIYNS
LQHDKQSQERLLVPYLETLQNQINCGDTVVCKAFQEKLAQKNITIGFTDENYSPDPRTPQ
NGWNGQHDMRKFMFEINSILSSLPSSNMGFWSEVIPIQSKPGLLAVVRKNGLGLSSDTDI
AIVNMDPSQKVELTRDDIHQLACNFQKRVIPEYTYYNDGKDKQYNWHTNNPDFNMAYHTV
MSCIEAKRIHVDDSIKTNFPVHSANPYGMFSKKQSSKMNIAKIAKMSGEDTTLIEKGTND
TEGIIHDDQKTPPTITVEIKK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcaaaattagagatagtcaataaaacagaacgtgaagaaagtgtaatcctg
gatggtaatgggattttacgttgttataacatgtttcctactcaatttggaagcatagag
gagatgattgaatatcttcctcaattacaggccatgggatttaatgctgtatggataaat
cctgtacaaacagcaggggatgttcagggcttatttaagcgtgataagacaattggtgtc
agagcttataatgaggtgacaagaagtctatatgctatgacagattgtgatttgataagt
ccttattttaacccgctccctcctaatgttgatcctaagttgaaaaagcagctggatatg
gacgtaatgcagaagttcacatcagaagcccgcaataatggtttggtaccgatgtttgat
ttggttttaaatcacgttgccgccgattcacggcacagaaaagaacatcctgaatggttt
caaaaggatgtccatcctgattttaaggatgctattgcatttgactacagtgaccctcaa
atccgagatgaaattattgaacaattttggaagccttatatttataagtacatgattgat
tatggctttgagggtgttcgcattgatgctgtaggctatttaaatccagaattacgcaaa
caaatttatgcttatatttatgatcttgcggagcagtttaataaacctaaacccgttata
ttggatgagcttcttttcagtgggagtcagaagcttaccgatgtagttgatggtttgttg
cttccagaaaaagggccaacccatattactcgaggtacctattatgcgcaaagagatggt
tatggtggtttacccgggtggtgtaaggaggaggagggagttaaggctcaagtagtattc
ctggataaacaaaagaaattgcatccccatgccaaaggcggatgtattgctttctccggt
aatcatgatcataactccttagccatgacaatattggaagaaatggcagaacatcgtttg
gcaaatcatcacactttgcacggtgcgcaagaaaaatttaaacatgaaaggagctatgat
tatgacgaagctttagagtcagtcctgcgctattcttttgtgaaagatattcaaaatgag
attctaagcggtaatgaatcaacaattaaagaagtagaaacaagaatgcgtgaaaaaata
gctttctgtgctttaacatcaagcggcgggtggtatgctctatcaggtgatgaaacaggt
gatttattggcaaaacctgtattcagaagggttcacgctctggaccaaacctattatgca
caacgtactcatataatctttgataaaaaatatcccgacaacaaagtagctatggaggta
ttaaccgaaatggctatagagaatatccaaaaagaaaaagctggaagcatctataacagt
ttacagcatgataaacaatcgcaagagcgattgctcgttccttatctggagactttgcaa
aatcaaattaattgtggcgatacagttgtttgcaaagcattccaagaaaaacttgcccag
aaaaatataacgattggttttacagacgaaaattatagtccggatcccagaacacctcaa
aatggttggaacggccaacatgatatgaggaaatttatgtttgaaatcaatagtatatta
agttccttgccgagttccaatatggggttttggagtgaagttatcccaatccagtcaaaa
ccagggttgcttgcagttgtacgtaaaaatgggctaggcttaagttctgatactgatatt
gcgatcgttaatatggatccaagtcaaaaagtcgagctaacaagagatgatattcatcaa
ttagcctgtaatttccagaaacgagtaattcctgaatatacttattacaatgatggtaaa
gacaaacagtataattggcatacaaataatcctgattttaatatggcttatcatacagtg
atgtcgtgtatcgaagccaaaaggatacatgttgatgattcgattaaaactaatttccct
gttcattcagcaaatccctatggcatgtttagcaaaaagcaatcatcgaaaatgaatata
gccaagatagcaaaaatgtccggggaagataccactttaattgaaaaaggtactaatgat
actgagggtatcatacacgatgatcagaaaactccacccacaataactgtagaaatcaaa
aaataa

DBGET integrated database retrieval system