KEGG   Legionella pneumophila subsp. pneumophila Lorraine: LPO_2508Help
Entry
LPO_2508          CDS       T02175                                 

Definition
stearoyl-CoA-9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lpo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LPO_2508
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LPO_2508
Enzymes [BR:lpo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LPO_2508
Lipid biosynthesis proteins [BR:lpo01004]
 Desaturase
  First
   LPO_2508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2624084..2625289
Genome map
AA seq 401 aa AA seqDB search
MFFGILNLTLWGYVLATFVLTQITIASVTLYLHRYQTHRALTMHPIVSHFFRLWIWLTTG
IVTRVWVAIHRKHHAMTDVEGDPHSPQIFSIKKVFWQVPELYREAAKDKDMIEKYSHGTP
NDWIERNLYSRYSSKGILLMFLIDLLLFGFPGITIWAIQMIWIPLSAGVVNGVGHYWGYR
NFECFDRSTNVFPLGFLIGGEELHNNHHTYASSAKFSVKWWEFDLGWFYIRCLSFLRLAK
VKKLPPKLARDDTKQYVDLNTIKALISNRFQIMSDYYKRVTIPILKNEKRNYNYIKNKKE
WHLFKEAKRLLRQETTKTNSHLQVLLNRFEQLQLVYNYRQSLQQIWLKKVSSQKELIESL
NQWCKKADESGLDVLHQFSLRIKSYVLIETDGSSLEAPQSK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttttttggtattttaaatctcacactttggggatatgttttagcaacttttgttcta
actcaaatcaccattgcttcagtcactctttatttgcatcgttatcaaacccatcgtgct
ttaaccatgcacccaatagtgagccatttttttcgactctggatttggttaacaaccggt
atagtgacaagagtatgggttgctatccatcgtaaacatcatgcaatgacagatgttgaa
ggagaccctcatagcccccaaatctttagtattaaaaaggtcttttggcaagttcctgaa
ttgtaccgggaagcagcaaaagataaagatatgattgaaaagtattctcatggcactcca
aacgactggattgaacgcaatctgtactctcgctattccagcaagggtatactacttatg
tttctaattgatttgctgctgtttggttttcctggaattactatttgggcaatacaaatg
atttggattccgctctcagcaggtgtagtaaatggagtggggcattattggggatatcgc
aattttgaatgctttgataggtcaaccaatgtatttcctttgggctttctaataggtgga
gaggagcttcataataatcaccacacttacgcttcgtctgctaaattttctgtgaaatgg
tgggagttcgatttgggctggttttatatacgttgcctatcttttttaaggcttgccaag
gtaaaaaaattaccccccaaattggcaagagacgataccaaacaatatgttgatttaaat
actataaaagccctcattagtaatcgttttcaaattatgtccgattactacaaaagggta
accattcccatcttgaaaaatgaaaaacgtaactataactatattaaaaataaaaaagaa
tggcatttatttaaagaagctaaacgcctattacgccaagaaaccacaaaaactaactcg
cacttgcaagtcttactaaatcgttttgagcaattacaacttgtctataattatcgccaa
tcattgcaacagatttggttaaaaaaagtatcctctcaaaaggagttaattgaatcttta
aaccaatggtgcaaaaaagccgacgaatcaggcctggatgtattgcatcaattttctctt
cggataaaaagctacgttttaattgaaacagatggctcatcactagaagcgccccaatca
aagtga

DBGET integrated database retrieval system