KEGG   Legionella pneumophila subsp. pneumophila Lorraine: LPO_3147Help
Entry
LPO_3147          CDS       T02175                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine
Brite
Enzymes [BR:lpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LPO_3147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3280815..3281600
Genome map
AA seq 261 aa AA seqDB search
MKINDFRYMRRGKHLSELQSEEANLLAPVNQRGKGTERALLVLHGFSSSPAVYRYLIPNL
KNYDAILCPVLAGHAESIEAFSKSKAADWLQSAKNACELLINQYQKVDVLGLSLGGLLAC
QLSQSYAINHLFLLAPALKLHMRINAMLKLAQILKCLGFRQLRNAAGNLITDEHAEIAYR
KLPICTIIEMLTLAQQYEWLPPACPADLFLGTHDQVVASQQVEQLFCNLPNVKIHWLKNS
AHVLPLDNDLNEIIDCINKSK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaatgattttcggtatatgcgccgcggcaaacatctcagcgaactgcagtcg
gaggaagcaaatctccttgctccagtcaatcagcgtggtaaaggcacagaacgagcttta
ctggtattgcatggcttctcttcttcaccagcagtttaccgatatctgattcctaattta
aaaaattatgatgccatcctttgtcctgtattggctggtcacgccgaaagtatagaagct
ttttcaaaatccaaagctgctgattggcttcaatcagcaaaaaacgcctgtgaactctta
ataaatcaatatcaaaaagttgatgttttagggttatcccttggaggattattagcctgt
caattaagtcaatcctatgctatcaatcacctgtttctattagcccctgcattaaaatta
cacatgcgcatcaacgctatgctgaaattagcccagattcttaagtgcctgggatttcga
caacttcgcaacgctgcagggaatcttatcaccgatgagcatgctgaaatcgcttataga
aaactaccgatttgtacaataattgaaatgctaaccttggctcagcaatatgaatggctc
cctcctgcttgcccggccgatctttttcttggaactcatgatcaagtggttgcttctcaa
caagtagaacaattattttgtaatttacctaatgtaaaaatacattggttaaaaaattcc
gcgcatgtattgccactagacaatgatctgaatgaaattattgattgtattaataaaagt
aagtga

DBGET integrated database retrieval system