KEGG   Legionella pneumophila Paris: lpp0003Help
Entry
lpp0003           CDS       T00209                                 

Gene name
recF
Definition
RecF recombinational DNA repair ATPase
Orthology
K03629  
DNA replication and repair protein RecF
Organism
lpp  Legionella pneumophila Paris
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lpp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2676..3737
Genome map
AA seq 353 aa AA seqDB search
MILSEVRIHNFRNIASTSLILNPNFNCITGPNGSGKTSLLEALYMLSCAHSFRSREVAPI
ISYGQNQLNVFAHAYDESTISVQKSITDGTQIKLNNQFCCTTSQLAYALPCQVIYSDIFQ
IIDAGPSVRRSLLDWGLFHVKHDYLKIWKDYKRILSQRNALLKSRATYEHFIPWDQQLSQ
LANQLDKARNDYFFQWQPKFYQVLSDLTNISCTVEYYKGWDRKNAGQNIEELLQKSFDSD
RNKLYTQYGPHQADLIISIEQYRVKHTLSRGQQKIILIALKLAQGQLLDKDCLYLIDDLA
AELDDYHQRNLIKYLTQQKGQFVITNLINNNNYDILPIDSGLFEVNCGAIKIL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgattttatctgaagttagaattcataattttcggaatatcgcttcgactagtttaatc
ctaaatcccaattttaattgtattacaggacctaatggcagtggtaaaacctcgttatta
gaggctctttacatgttgagttgcgcccattcttttcggtctcgtgaagtagctccaatt
atttcttatggtcaaaaccaacttaatgtttttgcccacgcttacgacgaaagcactatt
agtgttcagaaatctataacagacggcacacaaattaaattaaataatcagttttgttgt
actacaagtcagctagcctatgcgcttccttgccaggttatttactctgatatttttcaa
attattgatgccggtccctcagtaaggagaagcttgcttgattggggtttgtttcacgtg
aaacatgattatttgaaaatttggaaggattacaagcgcatacttagccaacgaaatgcc
ttattaaaatccagagctacttatgagcattttattccttgggaccaacagctaagtcaa
ttggcaaatcaactggataaagccagaaatgactatttttttcaatggcaacctaaattc
taccaagtcttaagtgatctaaccaatatatcctgcacagttgagtattacaaagggtgg
gatagaaaaaatgcagggcagaacattgaggaactgcttcagaaatcatttgatagtgat
agaaataaactatatacgcaatatggaccccatcaagctgatttgataattagcattgaa
caatacagagtaaagcatacactctctcgtggacaacaaaaaataattctaatcgccctt
aaattggctcaaggtcagctattagataaggattgcttgtatcttattgatgatttggct
gctgagttagatgactatcaccagcgaaatttaattaagtatctgacacagcaaaagggg
cagtttgttataacgaatttaattaacaacaataattacgatatcctgccaattgattca
ggtttgtttgaagtaaactgtggcgcaattaaaattttataa

DBGET integrated database retrieval system