KEGG   Legionella pneumophila Paris: lpp0486Help
Entry
lpp0486           CDS       T00209                                 

Gene name
glk
Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lpp  Legionella pneumophila Paris
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpp0486 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpp0486 (glk)
   00052 Galactose metabolism
    lpp0486 (glk)
   00500 Starch and sucrose metabolism
    lpp0486 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    lpp0486 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lpp0486 (glk)
   00524 Butirosin and neomycin biosynthesis
    lpp0486 (glk)
Enzymes [BR:lpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lpp0486 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
530135..531142
Genome map
AA seq 335 aa AA seqDB search
MNFFMMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEISPCAEFISLESALLTYKTR
HSLQEIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEVLEVMNDFTAIAMSLPV
LSTQDLVQIGNGYLDASKVRVVLGAGTGLGVAYLIPHQHHYSAFAGEGGHADWGAKTEQE
WFIYRYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEFLSAAQIISLALNQECFIA
HKAVAQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSLVHQSDFRIQFEDKGRFSDF
NALIPTYVIAAAQPGILGASVSLKQILTGASHVLF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttttatgatgcctcatgatttagcgcagtatgcgattgttgcggacataggc
ggtacttttgctcgtttcagtagagttaatcttgtcaatttgcagatggataaaattgaa
atttctccttgtgccgagtttattagtttggagtccgcgctattaacttataaaacccgg
cattctttgcaagaaataaaacatattgcgatagcgattgcgtgtccagtcatcgatgat
ttggtttctatgacgaattgtcattggcaattttcaataacagagttaaaacagagactt
ggccttgaagttctggaagtcatgaatgattttactgcgattgcgatgagtttacctgta
ttatcgactcaggatctggtgcagattggtaatggttacctggatgccagtaaagtgaga
gtggtgttaggcgcaggaaccggtttgggtgttgcttatttaattcctcatcaacatcac
tatagtgcttttgcaggggaaggggggcatgctgattggggagcaaaaactgagcaggaa
tggtttatctatcgttatttaaaaagtaaatactcccatgtatcttatgagcgtttgctg
tctggtcaaggactggaaaatttatatcaagctttagccgcgtatcatagtaaaaaagtt
gaatttttgtcagcagcgcaaattatatctttggcattaaatcaggaatgtttcatagct
cataaggcagtagcccaatttttttcaagtttgggatcgtttgctggtgatttagcatta
acttatggagcttttggtggtgtttatattgcaggagggattatgccgcgtttgctctcc
ttggtacaccaaagcgactttagaatccaatttgaagacaaaggacgatttagtgatttt
aatgccttaattcccacttatgtcattgcagccgctcaaccaggtattttaggcgcgagc
gtcagtttaaaacaaatattgacaggagcttctcatgtccttttctga

DBGET integrated database retrieval system