KEGG   Legionella pneumophila Paris: lpp0489Help
Entry
lpp0489           CDS       T00209                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
lpp  Legionella pneumophila Paris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    lpp0489
Enzymes [BR:lpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     lpp0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(533416..534723)
Genome map
AA seq 435 aa AA seqDB search
MLKRIFFLMIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVASPSQYNPNYYYDWIR
DSAIAMGLVETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQDILGEPKFYINGNPF
DGEWGRPQNDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNTMDPQSMGTIKMDLEYIA
HHWQDANFDLWEEVYGHHFFTAMTQQKALTDGAILAHQLHDRQAAVFYEMQANLINSRLQ
QHLDHQNKIIQATLLPHPGPQKTLELDSSVMLGILTNPQKEGVFAPHHTFVRNTAKALHE
QFNLMFPINKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYFTMAHNLSLNS
SNKLHIQNYLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLTWSYVSVLRAIHLR
EQLENRIKTMGWNTY
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaggatctttttcttaatgattttttttgtctctcaaactatggcttcagta
tttacccatgaagaggttcaaatattaaaaaaacattttttaaataactttcaaaccaat
ggagccatcgtagcctcaccctcgcagtacaaccccaattattattatgactggattcga
gactcagccattgccatgggattggttgagacatggtatgaagccagccaatctgctcga
tataaaaaacttttattagaatacgtttcatggacagaaaaaatacagcatcaagcggat
cccattgctggccaggatatattgggtgaacccaaattttatatcaatggcaatcctttt
gatggggaatggggacgaccacaaaatgatggtccggcactcagagcatctgttttaatt
cgttttgcgcaacagcttctcgatcataatgaaatagattatgtcaaatcacatctttat
aacaacaccatggacccacaatccatgggcactatcaagatggatttggaatacatcgca
catcattggcaagatgcaaattttgacctgtgggaagaggtttatggccatcattttttc
acggctatgacacaacaaaaagcgctgaccgatggcgccattttggctcaccagcttcat
gacagacaagctgctgttttttatgaaatgcaagccaacttaattaacagtcgactgcaa
cagcatttggaccatcagaataaaataattcaagctacattattacctcaccctggtcct
caaaaaacactagagcttgattcgtccgtcatgttgggtattttaactaatccacaaaaa
gaaggtgtttttgccccacatcacacctttgtgcgaaatactgcaaaggctttgcatgag
caatttaatttgatgtttcctattaataaaaaccgttctggagcaatattgtttggtcgt
tatcctggcgatacttatgatggctatcaaacaaacagcataggaaacccctggtttatc
ttaacagctacgatggctgaatattattttaccatggctcataatctgtccctgaacagc
agtaataaacttcatatacagaactatctaaagaaaggggacaattacctaaggctgata
aaacaatatggccctgatctgaatttaagtgagcaaattaatttgaataccggagttcag
caaggagcgacatccttgacctggagttacgtttccgtcttgcgagctattcatttaaga
gagcaattggaaaatagaataaaaactatgggctggaatacctattag

DBGET integrated database retrieval system