KEGG   Legionella pneumophila Paris: lpp0599Help
Entry
lpp0599           CDS       T00209                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00020  Citrate cycle (TCA cycle)
lpp00640  Propanoate metabolism
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01120  Microbial metabolism in diverse environments
lpp01130  Biosynthesis of antibiotics
lpp01200  Carbon metabolism
Module
lpp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpp0599 (sucC)
   00640 Propanoate metabolism
    lpp0599 (sucC)
   00660 C5-Branched dibasic acid metabolism
    lpp0599 (sucC)
Enzymes [BR:lpp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     lpp0599 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAH11747
Pasteur: lpp0599
UniProt: Q5X7K6
Position
644558..645721
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKQLFASYGLPVPRGEVAYNVEDALLVASQLSTSRWVVKAQVHAGGRGKAGGV
KLVSSKDELAAVAKSMLGTRLVTYQTDARGQPVNAILVEETCEIDKELYLGAVVDRATRR
VVIMASTEGGVEIEKVAHETPEKIFKVVVDPLVGVMPFQCRETAFKLGLKDDQIKQFTHL
MMGLGKMFVDCDLSLLEINPLVITKSGQLICLDGKINIDGNALFRQPKLKNMRDVSQEDD
RENRASDWELNYIPLDGTIGCMVNGAGLAMATMDVIKLHGGEPANFLDVGGGATKERVSE
ALKIIVSDEKVKGILVNIFGGIVRCDLIADGILAAVKEVDVKIPVVVRLEGNNAQLGAEI
LNKSNLNVIAATSLTDAAKKIVAAVSE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaatatcaagccaagcaattgttcgctagctatggtttaccagttcct
cgtggtgaggtcgcttataatgttgaagatgccttgctcgttgcttctcaattatcaacc
tctcgatgggttgtgaaagcacaagtccatgctggtggaagaggtaaagcaggtggtgtg
aaactggtttctagcaaagatgaattggctgcagttgcgaaatccatgttaggcacacgt
ctggttacttatcaaactgatgccagaggtcaaccagttaatgccattttggttgaagaa
acctgcgaaatagacaaggaattatatcttggtgctgttgttgatagagccaccagacga
gttgtcattatggcctccacagaaggtggtgttgaaattgaaaaggttgctcatgaaaca
cctgagaaaattttcaaggtggttgttgaccccttagttggtgttatgccctttcaatgt
cgtgaaacagcttttaaacttggattaaaagacgatcaaatcaaacaattcactcatttg
atgatgggattagggaaaatgtttgttgattgtgatttaagtttattagagataaatccg
cttgtcataacaaaatcagggcaactgatttgtctggatggaaaaattaatatcgatgga
aatgctttattccgacagcctaaattgaaaaatatgcgagacgtttcccaggaagatgat
cgagaaaatcgtgccagtgattgggaacttaattatattcctttggatgggacaataggt
tgcatggtaaatggtgctggtttggctatggctaccatggacgtgataaaattacatggt
ggtgagccggctaatttcctggatgttgggggaggcgccacaaaagaaagagtcagcgaa
gctttgaagattattgtgtcagatgaaaaagtcaaaggaattctagttaatatttttggt
ggaatcgttcgttgtgaccttattgctgatggaattcttgctgctgtaaaagaagtggat
gtaaaaattcctgttgttgtcagactggaaggtaataatgcccagttaggtgctgagata
ttgaataaaagcaatttaaatgtgattgctgcaacgagtttgacagacgcagccaagaaa
attgtagcagcagtttccgaataa

DBGET integrated database retrieval system