KEGG   Legionella pneumophila Paris: lpp0618Help
Entry
lpp0618           CDS       T00209                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpp  Legionella pneumophila Paris
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    lpp0618
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    lpp0618
Enzymes [BR:lpp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     lpp0618
Lipid biosynthesis proteins [BR:lpp01004]
 Desaturase
  First
   lpp0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
664965..666152
Genome map
AA seq 395 aa AA seqDB search
MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHPVVSHFFRFWLWLTTG
MVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYREARKDRDMVAKYSHGTP
TDWIERNVYSRHSSKGILLMLLLDLFFFGIPGMTVWAIQMMWIPLFAAGVINGIGHYWGY
RNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWWEFDIGWMYIRILSLFGLA
KVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSYYYKNVIRPILKHEKNTSIETKEDK
KLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYSYKQSLQNVWLKTATTQKELV
EALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtattcggctttttaaacctgtctttctggggatatgttctcgcaacttttatcctg
actcaaatcacaattgcatctgttactatctatcttcatcggaaccagactcatagagcg
ctaacattgcaccctgtggtcagtcattttttccgtttttggttatggttaactacgggt
atggttactgcggattgggttgctatccatcgcaagcaccatgcaacaactgatgttgag
ggagaccctcatagcccagtggttgagggaatcaggaaggtattttggcaaggcgctgag
ctttacagagaggcacgcaaggacagggatatggttgccaaatattctcatggcacacca
accgattggatagagcgtaatgtctactcgcgccattcaagtaaaggtattttgctgatg
ttattactggatttatttttcttcgggattcctggaatgactgtatgggcaatccaaatg
atgtggattccgctgtttgctgcgggagtcatcaatggtatcggccattattggggatac
aggaattttgaatgtcccgatgctgctactaatatcattccctggggattttggattggt
ggagaagagttacataataatcatcacacttttgcttcctcagccaaattttcagtgaaa
tggtgggagtttgatattggttggatgtatattcgcattctttcccttttcggtttggcc
aaggtaaaaaaattacctcccaaattggctatggatgaaggaaaattccatgttgatctg
gatactgtgagagcagttatttcaaatcgctttcaagtgatgtcttattactataagaat
gtcatcagacctattttgaagcatgaaaaaaacaccagcattgagacaaaagaagacaag
aaattgtttcaacgggcaggtagattactgcgtcgagaggataagctattatcgacaaaa
gctaaaactcgtttgcaaaagctgctcgatgcccgcgaacagttgagagtggtttactct
tacaagcaatcattacaaaatgtttggctgaaaacagcaacgactcaaaaagaattagta
gaagctctgcagcaatggtgccgccaggcagaggaatcgggtcttgatgtgctgaaacag
tttgcccaacaattgaaaggctacgtaccggtatataccagggagtga

DBGET integrated database retrieval system