KEGG   Legionella pneumophila Paris: lpp0618Help
Entry
lpp0618           CDS       T00209                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpp  Legionella pneumophila Paris
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lpp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lpp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
664965..666152
Genome map
AA seq 395 aa AA seqDB search
MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHPVVSHFFRFWLWLTTG
MVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYREARKDRDMVAKYSHGTP
TDWIERNVYSRHSSKGILLMLLLDLFFFGIPGMTVWAIQMMWIPLFAAGVINGIGHYWGY
RNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWWEFDIGWMYIRILSLFGLA
KVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSYYYKNVIRPILKHEKNTSIETKEDK
KLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYSYKQSLQNVWLKTATTQKELV
EALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtattcggctttttaaacctgtctttctggggatatgttctcgcaacttttatcctg
actcaaatcacaattgcatctgttactatctatcttcatcggaaccagactcatagagcg
ctaacattgcaccctgtggtcagtcattttttccgtttttggttatggttaactacgggt
atggttactgcggattgggttgctatccatcgcaagcaccatgcaacaactgatgttgag
ggagaccctcatagcccagtggttgagggaatcaggaaggtattttggcaaggcgctgag
ctttacagagaggcacgcaaggacagggatatggttgccaaatattctcatggcacacca
accgattggatagagcgtaatgtctactcgcgccattcaagtaaaggtattttgctgatg
ttattactggatttatttttcttcgggattcctggaatgactgtatgggcaatccaaatg
atgtggattccgctgtttgctgcgggagtcatcaatggtatcggccattattggggatac
aggaattttgaatgtcccgatgctgctactaatatcattccctggggattttggattggt
ggagaagagttacataataatcatcacacttttgcttcctcagccaaattttcagtgaaa
tggtgggagtttgatattggttggatgtatattcgcattctttcccttttcggtttggcc
aaggtaaaaaaattacctcccaaattggctatggatgaaggaaaattccatgttgatctg
gatactgtgagagcagttatttcaaatcgctttcaagtgatgtcttattactataagaat
gtcatcagacctattttgaagcatgaaaaaaacaccagcattgagacaaaagaagacaag
aaattgtttcaacgggcaggtagattactgcgtcgagaggataagctattatcgacaaaa
gctaaaactcgtttgcaaaagctgctcgatgcccgcgaacagttgagagtggtttactct
tacaagcaatcattacaaaatgtttggctgaaaacagcaacgactcaaaaagaattagta
gaagctctgcagcaatggtgccgccaggcagaggaatcgggtcttgatgtgctgaaacag
tttgcccaacaattgaaaggctacgtaccggtatataccagggagtga

DBGET integrated database retrieval system