KEGG   Legionella pneumophila Paris: lpp0638Help
Entry
lpp0638           CDS       T00209                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lpp  Legionella pneumophila Paris
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lpp00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lpp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
688811..689704
Genome map
AA seq 297 aa AA seqDB search
MKHFLEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYENSTRTRISFELAERH
LAMSVVNLDLQTSSEIKGEAIEDTIRTLAAMGIQYFVIRHKQDGLQQNLANKLGDTVHII
NAGDGTHAHPSQAILDMVTIIEQKKRLDKLKIAILGNIKHSRVANSFQCICSKLGVGDLV
LISPEIWQPSQVHFGRVTDNLNEGLEGADVVICLRVQRERLLEDDHLDLDFYRNNFALTQ
KSLSYAKPDAMVMHPGPMNRGVEIDSEVADGNQSCILQQVTNGVYARMAILESLIAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttcttgaaattagtcaattgtcatctgaacaaattgaatccttattgcaa
cgagctttatattttaaacatacaaagcaatacccttcttattcccaaagtattattgct
aatttattttatgaaaacagtacccgaactcgcatcagctttgagttagcagagcgccat
ctggcaatgtctgtagtaaatcttgatcttcagacctcatcagaaattaaaggcgaagcc
attgaagataccatcagaacgctagcagctatgggtatccagtattttgtaattcgccat
aagcaagatgggctgcagcaaaatttagctaataagttaggtgatacagttcatataata
aatgctggtgatggaactcatgctcatccaagccaagcaatactggatatggtgacaatt
attgaacaaaaaaagcgattagataaattaaaaattgctattttgggaaatattaaacat
tcacgtgttgctaattctttccaatgcatttgcagtaaactaggggttggtgacttggtt
ttaatttctccagagatttggcaaccatcacaagtgcactttggacgggttactgataat
ctcaatgaaggtctggaaggtgcggatgtggtaatttgcctgcgagttcaaagggaacgc
ttgctggaagatgatcatttggatttggatttttatagaaacaattttgcacttactcaa
aaaagtctgtcttatgcaaaacctgacgctatggttatgcaccctgggcctatgaatcgc
ggggttgaaattgatagtgaagtggctgatggcaaccaatcttgtattttacaacaggtt
actaacggtgtttatgcaagaatggctatccttgaatcgctgatagcgagttag

DBGET integrated database retrieval system