KEGG   Legionella pneumophila Paris: lpp0895Help
Entry
lpp0895           CDS       T00209                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthases
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01130  Biosynthesis of antibiotics
lpp01230  Biosynthesis of amino acids
Module
lpp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpp0895 (trpC)
Enzymes [BR:lpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     lpp0895 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth NanE HTH_5
Motif
Other DBs
NCBI-ProteinID: CAH12046
Pasteur: lpp0895
UniProt: Q5X6S0
Position
complement(1006173..1006949)
Genome map
AA seq 258 aa AA seqDB search
MNSILERIAKHKLEEVAVAKKNKPLHVLSKQQPGEMRDFITALKSNTSPAVIAEIKKASP
SKGLIRKDFNVAEIAKIYTQNGARCLSVLTDIEFFQGHPDYLALAKSKTTLPVLRKDFII
DSYQIYESLVLGADCILLIVALLDDVQLMDFCQLAQELKMSVLVESHTQDELERALRLPT
PLIGINNRSLHNFKTDIQLSIQLKQFVPKDKIIITESGINTREDIKLMQSHGINAFLIGE
SLMRADNIGKALQKLMTD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtatcctggaacgaatagcaaaacataaactagaagaagttgcagttgcgaaa
aaaaataagcctttacatgttctgtcaaaacaacagccgggggaaatgcgtgacttcata
actgctttaaaatccaatacctcacctgcagtcatagctgagataaaaaaggcttctcca
agcaaaggtttaattcgaaaagattttaatgttgcagaaattgccaagatttatacccaa
aatggcgcaagatgcttatccgttttaacggatattgagttttttcaaggtcatcctgat
tatttggctttagcaaaatcaaaaaccactttgcccgtattgcgtaaagactttattatt
gattcttatcaaatctatgaaagccttgtcttgggtgctgattgcattttactgattgtc
gcattattagatgatgttcaattaatggatttttgccaactggctcaagaacttaaaatg
tctgttttggttgaaagccacacgcaagatgaattagaaagagcattacgcttacccacc
ccccttataggcattaataaccgcagcctacacaactttaaaacagacattcaactgagt
atccaattaaaacaatttgttcctaaagataaaattattattactgaaagcggaatcaac
acccgtgaagacataaaattaatgcaatcccatggcattaatgcctttttgattggagag
agtttaatgagggcagataacatcgggaaagcattacagaaactaatgactgactaa

DBGET integrated database retrieval system