KEGG   Legionella pneumophila Paris: lpp1201Help
Entry
lpp1201           CDS       T00209                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lpp  Legionella pneumophila Paris
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lpp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lpp00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1339932..1341227)
Genome map
AA seq 431 aa AA seqDB search
MLTIKNWQLLSDNDKRRCLSRPRDNSAIKENVLEIINQVQLSGDKALYDLTKRFDRVNLQ
YLQISQEKIRQASIPQNALIAIKQAIETISSYHQFLLPENTEISTASGITIRNVYRPIQK
VGLYVPGGNKTPLVSSLLMQAIPAKVAGCPIKVLCTPPDAEGEINEHILVAARLCGIDTI
YAIGGAQAIAAMAYGTESVIKVDKIFGPGNSYVTQAKTLVAIDADGAAIDMPAGPSEVMI
LADTEANPEFIAADLLAQAEHGPDSQVILICDECELANQVNQQLEIQMSYLSRIEFIKQS
LTNSRIIICSNQSEQLDIINSYAPEHLIINRKNPEPWVEKIVAAGTVFLGSWAAETMGDY
VTGSNHVLPTSGFARNHSGLSTLDFMTRFTVQAINQEAIRNLGPAAMTLAELEGLDAHAN
AVQIRLNTLGD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgataaaaaactggcaattactgtctgataacgataaaaggcgatgcctttca
aggccacgagacaattctgcaataaaggaaaatgtgctggaaattataaatcaggtccaa
ttatcaggagataaagcactttacgatttaaccaaacggtttgatagagtcaatttacaa
tatttacagatctcacaggaaaaaattagacaagccagcataccgcaaaatgccttaatc
gccataaaacaagccattgaaacaatctcgtcatatcaccagtttttgttgcctgaaaat
accgagatttcgactgcatcaggaattacaatccgcaatgtctacagaccaatccaaaaa
gttggcttgtatgtgcctggaggaaataaaacacctttagtttcttcacttctcatgcag
gcaataccggcaaaggtagcgggctgcccaataaaagtgctttgtactccccctgatgca
gaaggggaaattaacgagcatatcctggtagctgcaagattatgtggtattgacacaatt
tacgctataggtggagctcaagccatagcggctatggcttatggcactgaaagtgtcatc
aaagtggataaaatatttggaccgggtaacagctatgtcactcaggcaaaaactttagtt
gcaattgacgccgacggagctgcgattgacatgcccgctgggccatctgaagtgatgatt
cttgcagatactgaggcaaaccctgaatttattgctgcagatttattagcccaggctgaa
catggcccggattcacaggttattttaatttgtgatgaatgtgaattggcaaaccaggtt
aatcaacagctagaaattcagatgagttatttatcaagaatagaatttatcaaacaatct
ctcacgaatagcaggataattatctgttctaatcaatcggaacagctggatattatcaac
tcctacgctccggaacacctgatcattaacagaaaaaaccccgagccatgggttgagaaa
atcgtggctgccggaacagtattccttggctcttgggccgcagaaacaatgggtgactat
gtaacaggaagcaatcacgtcttacctaccagtggttttgccagaaaccatagcgggctt
tctactcttgattttatgacacgatttaccgtgcaagccataaatcaggaggctatccgt
aatttaggtccagcggcaatgactttagcggaattagagggtttggatgctcatgccaat
gccgttcaaataagactcaatactctgggggattaa

DBGET integrated database retrieval system