KEGG   Legionella pneumophila Paris: lpp1201Help
Entry
lpp1201           CDS       T00209                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00340  Histidine metabolism
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01230  Biosynthesis of amino acids
Module
lpp_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    lpp1201 (hisD)
Enzymes [BR:lpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     lpp1201 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAH12352
Pasteur: lpp1201
UniProt: Q5X5W9
Position
complement(1339932..1341227)
Genome map
AA seq 431 aa AA seqDB search
MLTIKNWQLLSDNDKRRCLSRPRDNSAIKENVLEIINQVQLSGDKALYDLTKRFDRVNLQ
YLQISQEKIRQASIPQNALIAIKQAIETISSYHQFLLPENTEISTASGITIRNVYRPIQK
VGLYVPGGNKTPLVSSLLMQAIPAKVAGCPIKVLCTPPDAEGEINEHILVAARLCGIDTI
YAIGGAQAIAAMAYGTESVIKVDKIFGPGNSYVTQAKTLVAIDADGAAIDMPAGPSEVMI
LADTEANPEFIAADLLAQAEHGPDSQVILICDECELANQVNQQLEIQMSYLSRIEFIKQS
LTNSRIIICSNQSEQLDIINSYAPEHLIINRKNPEPWVEKIVAAGTVFLGSWAAETMGDY
VTGSNHVLPTSGFARNHSGLSTLDFMTRFTVQAINQEAIRNLGPAAMTLAELEGLDAHAN
AVQIRLNTLGD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgataaaaaactggcaattactgtctgataacgataaaaggcgatgcctttca
aggccacgagacaattctgcaataaaggaaaatgtgctggaaattataaatcaggtccaa
ttatcaggagataaagcactttacgatttaaccaaacggtttgatagagtcaatttacaa
tatttacagatctcacaggaaaaaattagacaagccagcataccgcaaaatgccttaatc
gccataaaacaagccattgaaacaatctcgtcatatcaccagtttttgttgcctgaaaat
accgagatttcgactgcatcaggaattacaatccgcaatgtctacagaccaatccaaaaa
gttggcttgtatgtgcctggaggaaataaaacacctttagtttcttcacttctcatgcag
gcaataccggcaaaggtagcgggctgcccaataaaagtgctttgtactccccctgatgca
gaaggggaaattaacgagcatatcctggtagctgcaagattatgtggtattgacacaatt
tacgctataggtggagctcaagccatagcggctatggcttatggcactgaaagtgtcatc
aaagtggataaaatatttggaccgggtaacagctatgtcactcaggcaaaaactttagtt
gcaattgacgccgacggagctgcgattgacatgcccgctgggccatctgaagtgatgatt
cttgcagatactgaggcaaaccctgaatttattgctgcagatttattagcccaggctgaa
catggcccggattcacaggttattttaatttgtgatgaatgtgaattggcaaaccaggtt
aatcaacagctagaaattcagatgagttatttatcaagaatagaatttatcaaacaatct
ctcacgaatagcaggataattatctgttctaatcaatcggaacagctggatattatcaac
tcctacgctccggaacacctgatcattaacagaaaaaaccccgagccatgggttgagaaa
atcgtggctgccggaacagtattccttggctcttgggccgcagaaacaatgggtgactat
gtaacaggaagcaatcacgtcttacctaccagtggttttgccagaaaccatagcgggctt
tctactcttgattttatgacacgatttaccgtgcaagccataaatcaggaggctatccgt
aatttaggtccagcggcaatgactttagcggaattagagggtttggatgctcatgccaat
gccgttcaaataagactcaatactctgggggattaa

DBGET integrated database retrieval system