KEGG   Legionella pneumophila Paris: lpp1251Help
Entry
lpp1251           CDS       T00209                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lpp  Legionella pneumophila Paris
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpp1251 (ruvA)
Enzymes [BR:lpp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     lpp1251 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1388148..1388747
Genome map
AA seq 199 aa AA seqDB search
MIGWLHGQIIDKHQPGKLVLDVNGVGYDVETSLNTFFQIENGNQPIGLHIHTIVREDALL
LYGFLDKEERSLFRSLIKVNGVGPKLAMTVLSSISPKEFIQCIHQENAALLTKLPGIGKK
TAERLVVEMRDSIKQFDGSVSDTFQKQAGSTHSQQEAISALEALGYKPQEAWKVVNKIDN
GNKSCEQLIREALQILSSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgataggctggctccatggtcaaattatagataagcatcagccaggaaaattggttctg
gatgtcaatggcgtaggatatgatgtagaaacatctttgaatactttttttcagatagaa
aatggtaaccaacctatcggattacatattcacaccatagttcgagaagatgctttgtta
ttgtatggcttcctggataaagaggagcgttctttattcagatcattaattaaagtgaat
ggggtaggccccaaactggctatgactgttttatccagtatttctcctaaagaatttatt
cagtgtattcaccaggagaatgctgctttattaaccaaattacctggcataggcaagaaa
actgcagagcgcttagtagttgaaatgagagacagtataaagcagtttgatggttcggtt
tccgatactttccaaaagcaggcaggtagcactcatagtcaacaagaggcaatcagcgcg
ttggaggcattaggctataagccacaagaggcttggaaagttgtgaataaaattgataat
ggcaataagagttgtgagcaattgattcgtgaggctttgcaaattctttcttcgcgatga

DBGET integrated database retrieval system