KEGG   Legionella pneumophila Paris: lpp1268Help
Entry
lpp1268           CDS       T00209                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lpp  Legionella pneumophila Paris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lpp1268 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpp1268 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpp1268 (trpB)
Enzymes [BR:lpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lpp1268 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
1405227..1406426
Genome map
AA seq 399 aa AA seqDB search
MIKKELPDEFGHFGPYGGMFVADTLVHALKQLEHAYTKYRNDQDFLSELHTELKDYVGRP
NPLYHAVHLSKKIGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQH
GVATATVAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSKTLKDALNEALR
DWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKTGRLPDALVACVGGGS
NAIGLFYPFLNDQSVMIYGVEAGGKGIETGEHSASLIAGKPGVLHGNRTYLLCDEYGQVK
DTHSVSAGLDYPGVGPEHAYLKDTGRVIYKAINDSEALDAFRLLTHTEGIIPALESSHAV
AYAIQLAKTMSKEQSIIVNLSGRGDKDMHTVAAIDGITI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagagcttccagatgagtttggccattttggcccatatggcggtatgttt
gtagccgatacattagttcatgctttaaaacaattagagcatgcctataccaaatatcgt
aatgatcaggattttctgtctgagttacacacagaattaaaagattatgtggggcggccc
aatcctctataccatgccgtacacttaagtaaaaagataggcggtgcacaaatttatctc
aagcgtgaagatttaaatcataccggcgctcataaaatcaataataccattggacaagcc
ttactcgccaaacgcatggggaaaactcgagtgatcgcagaaactggcgcaggtcaacat
ggcgttgcaactgctacagttgccgctaaatttgggtttcaatgcgttgtgtacatgggg
tcagaagacattaagcgtcaatccagtaatgtttatagaatgaaattgttaggtgctgaa
gtggtgcctgtcacttcaggatcaaagacgttgaaagatgctttaaatgaagcattgaga
gattgggtgagtcatgtcgacgacacgttttatattattggtactgttgcaggtccccat
ccttatcctcaaatggtaagagattttcaagcgattattggtgttgaagctcgagctcag
catatggaaaaaacaggccgtttgccagatgctttggtagcttgtgtcggaggtggatcc
aatgcaataggcttgttttatccctttttgaatgatcagtctgttatgatttatggggtt
gaagcaggagggaaaggcatagaaaccggtgagcattcagcatctctgattgctggaaaa
cctggtgtgttacacggtaatagaacctatttattgtgtgatgagtatggacaggtgaaa
gacactcattcagtatcagccggtctggattatcctggagttgggcctgaacatgcttat
ttaaaagatactggacgggtcatttataaagcaataaatgattccgaggccctggatgcc
tttcgcctgttaactcatacggaaggaattattccagcattagaatctagccacgcggta
gcctatgccatacaattggctaaaacgatgtcaaaagaacagagcatcatagtcaatcta
tctggtcgtggtgataaagatatgcatacagtagctgctattgacggtataacaatttaa

DBGET integrated database retrieval system