KEGG   Legionella pneumophila Paris: lpp1269Help
Entry
lpp1269           CDS       T00209                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00260  Glycine, serine and threonine metabolism
lpp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01130  Biosynthesis of antibiotics
lpp01230  Biosynthesis of amino acids
Module
lpp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpp1269 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpp1269 (trpA)
Enzymes [BR:lpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lpp1269 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth PI-PLC-X NanE
Motif
Other DBs
NCBI-ProteinID: CAH12420
Pasteur: lpp1269
UniProt: Q5X5Q1
Structure
PDB: 

Jmol
Position
1406452..1407270
Genome map
AA seq 272 aa AA seqDB search
MNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAE
GPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVE
AGADGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNFINQHANGYLYYVSLK
GVTGSDALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEI
IEAYEAKKDPLQASGALLSSMRQAIDNIGSMV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtattgataagactctggaaaaattaaaagccaatagaaaaaaaatgttaagt
ccttatattactgcaggcgatccatatcctgagttaacagtaagtttaatgcatcaattg
gttaaatcaggggcagatgtattggagctgggaatacctttttcagaccctatggcagaa
ggtcctgttatccaaagagcaatggaacgagctttggcgcattcaattcattgtgatgac
gtattgaatatggttaggcaatttcgcaaaacggataccgaaacgcctgtgattcttatg
ggatatttaaatcctatagaacaatatggctatgatctttttgctcaacaggcagtggag
gctggggctgatggaacaatattagttgatttgcctcctgaggaagctgatggagtatcg
cgagtttggcaaaaacatggtttgtacagtatttatttatgttcgccaaccacctcagct
gaaagaatgaactttataaatcagcatgccaatggttatctgtattatgtttcattgaag
ggagtgactggttctgacgcgcttaagttgccagaattaaaagctcaatatctacaacga
aaggcacaatcaaaattaccgcttatggttgggtttggaataaaaactccggaaatggct
gcacaagttgctgaatttgctgatggggtcattgttggggcggcactgataaatgaaatc
attgaagcctatgaggccaagaaagatccgctacaagcaagcggggctctattgagttcc
atgaggcaagctatcgataatattggaagtatggtatga

DBGET integrated database retrieval system