KEGG   Legionella pneumophila Paris: lpp1269Help
Entry
lpp1269           CDS       T00209                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lpp  Legionella pneumophila Paris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lpp1269 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpp1269 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpp1269 (trpA)
Enzymes [BR:lpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lpp1269 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
1406452..1407270
Genome map
AA seq 272 aa AA seqDB search
MNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAE
GPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVE
AGADGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNFINQHANGYLYYVSLK
GVTGSDALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEI
IEAYEAKKDPLQASGALLSSMRQAIDNIGSMV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtattgataagactctggaaaaattaaaagccaatagaaaaaaaatgttaagt
ccttatattactgcaggcgatccatatcctgagttaacagtaagtttaatgcatcaattg
gttaaatcaggggcagatgtattggagctgggaatacctttttcagaccctatggcagaa
ggtcctgttatccaaagagcaatggaacgagctttggcgcattcaattcattgtgatgac
gtattgaatatggttaggcaatttcgcaaaacggataccgaaacgcctgtgattcttatg
ggatatttaaatcctatagaacaatatggctatgatctttttgctcaacaggcagtggag
gctggggctgatggaacaatattagttgatttgcctcctgaggaagctgatggagtatcg
cgagtttggcaaaaacatggtttgtacagtatttatttatgttcgccaaccacctcagct
gaaagaatgaactttataaatcagcatgccaatggttatctgtattatgtttcattgaag
ggagtgactggttctgacgcgcttaagttgccagaattaaaagctcaatatctacaacga
aaggcacaatcaaaattaccgcttatggttgggtttggaataaaaactccggaaatggct
gcacaagttgctgaatttgctgatggggtcattgttggggcggcactgataaatgaaatc
attgaagcctatgaggccaagaaagatccgctacaagcaagcggggctctattgagttcc
atgaggcaagctatcgataatattggaagtatggtatga

DBGET integrated database retrieval system