KEGG   Legionella pneumophila Paris: lpp1460Help
Entry
lpp1460           CDS       T00209                                 

Gene name
aceF
Definition
(GenBank) Pyruvate dehydrogenase (dihydrolipoyltransacetylase component) E2p
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00010  Glycolysis / Gluconeogenesis
lpp00020  Citrate cycle (TCA cycle)
lpp00620  Pyruvate metabolism
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01120  Microbial metabolism in diverse environments
lpp01130  Biosynthesis of antibiotics
lpp01200  Carbon metabolism
Module
lpp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpp1460 (aceF)
   00020 Citrate cycle (TCA cycle)
    lpp1460 (aceF)
   00620 Pyruvate metabolism
    lpp1460 (aceF)
Enzymes [BR:lpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     lpp1460 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N PYNP_C NQRA HlyD_D23 HlyD_3 DUF4947
Motif
Other DBs
NCBI-ProteinID: CAH12611
Pasteur: lpp1460
Position
complement(1627975..1629609)
Genome map
AA seq 544 aa AA seqDB search
MTKESEIKIPDIGGANQVDVIEILVKEGDQIEVDTPLITLESEKASMDIPSPISGTVTQI
LVKVGDKVSEGDLIVKAKSDTTTNISSSQEQKTELEKQNSQTRPEEQSVDTKATASTPDS
KDIEISIPDIGGANDVDVIDILVKPGMEVEKDQALITLEGDKATMDIPSPYAGKVIEMKI
KLGDKVSQGTPILSLKTSGKTETPEIEKSQIKNISEQSIKEIEKPYEELKSEPISINNLE
IAESKSILISAGPAVRRLAREFGVDLSLVQGSGRKSRITKEDLQNYIKVRLNEKTTSGGF
SLPSNPAIDFSKFGSIETKPLNKIKKLTGANVHRSWITIPHVTQFDEADITDLEAFRKSE
SESTKNQDYKLTLLAFVCSVVCKALHAYPQFNASLDASGENLIYKKYYNIGIAVDTPNGL
VVPVIKNVDKLSVIDIAKEMSRLSTKAREKGLTPIDMSGGCFTISSLGGIGGTAFTPIVN
SPEVAILGLSRSTIKPIYDNKEFKPRLMLPISLSYDHRVIDGAEAARFTRFLCDCLGDIR
RVLL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaagtgaaattaaaattcctgatatcggtggcgctaatcaagttgatgtc
attgagattttagtgaaagaaggtgatcagatcgaagtggatacaccgttgattacgctt
gagtctgagaaagcaagcatggatatcccttctccaatatctggaacggtaacgcaaatt
ctagttaaagtcggtgacaaagtatccgaaggcgatctcattgtcaaagccaagtcagac
acaacgacaaatatttccagttctcaagaacaaaagactgaattagaaaaacagaattcg
caaaccagaccagaagagcaatctgttgatacaaaggcaactgcatctacacctgattcc
aaagatattgaaatatctatcccggatattggtggtgcaaatgacgttgatgtaattgat
attttagtcaaaccagggatggaagtagaaaaggatcaggcattaattacattagagggt
gataaagcaacgatggatattccttcgccctatgcaggtaaagtcatcgaaatgaaaatt
aaattaggggataaagtatctcaaggtactcctattctaagtctaaaaacctcaggaaaa
actgagacacctgaaatcgaaaaaagtcagattaaaaatatctcagaacaatctataaag
gaaatagagaagccatatgaagaactaaaatccgaaccaatatcgattaataaccttgag
atagctgaatcaaaaagtatcttaatatctgcaggcccagccgtaagaagattagcaaga
gagtttggagtcgatttatccttggttcagggaagtgggagaaaatctcgtattacaaaa
gaagacctgcaaaattatatcaaagtacgtttaaatgaaaaaaccacttctggcggcttc
agcttgccgtcaaatccagccattgatttcagtaaatttggttcaattgaaacaaagcct
ttaaataaaattaaaaagcttactggagcaaacgtacatcgctcctggataaccattcca
catgtcactcaatttgacgaagcggatattacagacctggaggcgtttagaaaatcagaa
tcagagagcactaaaaatcaagattacaaattaactctattagcatttgtttgtagcgta
gtttgtaaggctctccatgcttacccgcaatttaatgcgtcactggatgccagtggtgaa
aatttaatttataaaaaatattataatataggtatagcagtagatacacctaacggtctg
gtggttcctgtaataaagaatgttgataaattgagtgtgattgatattgcaaaggaaatg
tccagactcagtacgaaagctagagaaaagggattgacacctattgatatgtcaggaggt
tgttttacaatttccagccttggcggtataggcggaacggcttttactcctattgtaaat
agcccggaagttgcaattttgggcttatcaagatcaactataaaacccatatacgataat
aaagagtttaagcccagattgatgttgcctatttccctttcttacgatcatagagtaatc
gacggcgctgaggcagcccggtttactcgctttctttgtgattgtttaggtgatattaga
agagttttactctga

DBGET integrated database retrieval system