KEGG   Legionella pneumophila Paris: lpp1554Help
Entry
lpp1554           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00071  Fatty acid degradation
lpp00280  Valine, leucine and isoleucine degradation
lpp00281  Geraniol degradation
lpp00310  Lysine degradation
lpp00362  Benzoate degradation
lpp00380  Tryptophan metabolism
lpp00410  beta-Alanine metabolism
lpp00640  Propanoate metabolism
lpp00650  Butanoate metabolism
lpp00903  Limonene and pinene degradation
lpp00930  Caprolactam degradation
lpp01040  Biosynthesis of unsaturated fatty acids
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01120  Microbial metabolism in diverse environments
lpp01130  Biosynthesis of antibiotics
lpp01200  Carbon metabolism
lpp01212  Fatty acid metabolism
Module
lpp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    lpp1554
   00650 Butanoate metabolism
    lpp1554
  Lipid metabolism
   00071 Fatty acid degradation
    lpp1554
   01040 Biosynthesis of unsaturated fatty acids
    lpp1554
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lpp1554
   00310 Lysine degradation
    lpp1554
   00380 Tryptophan metabolism
    lpp1554
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lpp1554
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    lpp1554
   00281 Geraniol degradation
    lpp1554
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lpp1554
   00930 Caprolactam degradation
    lpp1554
Enzymes [BR:lpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     lpp1554
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     lpp1554
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     lpp1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 UDPG_MGDP_dh_N DAO Pyr_redox_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CAH12705
Pasteur: lpp1554
Position
complement(1727933..1729951)
Genome map
AA seq 672 aa AA seqDB search
MNNYKHWDLQRDKDAILWLGLNRRDAAVNSINEEVLDELNSLLHEISHDKKAMGLIIYSL
KEKGFIAGADVNAFSQFESSSQAVDFLQKGQTVFARLQTLSIPSVAMIDGFCMGGGYELA
LACTYRIATDDKDTRIGLPEVMLGIHPGWGGTVRLPQLIGGFKALSQVILTGSAIPAVKA
KSLGMIDEVVPVRQLRRAAVYFIKNKPPRHRASFIESLTNSSLLRKALAYLLRYNVAKRV
RKEHYPAPYAVIDLWEKEGGVGERAYLKEVDSIEKLVSQNDTAKNLIRAFLLRERLKGFA
KDSNFKATHVHVIGAGVMGGDIAAWCALRGLQVTLQDKSYEQIAPAIGRAHKLYSKKLRK
PRLIQAAMDRLIADPEGHGVKRADVIIEAVFENLAVKQEIMKIVEKNAKKDAIIATNTSS
IPLDEISSVMSKPERLVGIHFFNPVAKMDLVEIVSSSSTAKKIQQSSCAFVNQIGKLPLP
VKSSPGFLINRVLMPYLMECVQLLDEGYSAETIDEAALQFGMFMGPVELADTVGMDVCLA
VAENLTSHFGGTIPQRLRDLVKEGKLGRKTGEGFYKYKNGKVIKKKAPSHVDKTIADRLI
LRMVNESAACIREKVVEDSDLLDAGMIFATGFAPFRGGPMNYANDFGKDKLETLFKTFES
KYGERFKVDTSL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaataattataaacattgggatttacaacgagataaagacgccattctgtggcttgga
ttaaatagaagggatgctgctgttaatagcattaatgaagaagtcctggatgagttaaac
agcttgctgcatgaaatatcgcatgataaaaaagcaatgggattaattatttattcgctc
aaggaaaaagggtttattgcgggtgctgatgttaacgctttttcacaatttgagagctct
tcacaagcggtcgattttttgcagaaaggacaaactgtatttgcccggttgcaaacttta
tcaattccaagtgtcgcaatgatcgatggtttttgcatgggcggtggttatgagttagct
ttagcctgcacctatcgaattgcaacggatgacaaagacacacgtattggtttgcctgaa
gtgatgctgggtattcatccagggtggggcggtactgtgcgtttgcctcagttaataggc
ggttttaaagctttatcacaagtcatattaactggtagtgcaatacctgctgtaaaagct
aaaagccttggcatgattgatgaggtagtacctgttcgtcagctaagaagggctgctgtt
tatttcataaagaataaaccaccacgacacagggcatcatttattgaaagtttaacgaat
agctctttgcttagaaaagctctcgcttatttgcttcgttataacgtagccaagcgagtt
cgaaaagaacattatcctgcaccatatgccgtgattgacctgtgggaaaaagaaggagga
gtgggagagagggcttatcttaaagaagtggactctatagaaaaacttgtatcccaaaat
gataccgccaagaatcttatcagagcatttttattgcgtgagcgattaaaaggatttgcc
aaagacagcaacttcaaagcgacacatgttcatgtgattggagctggagttatgggaggg
gatatcgcggcctggtgtgctttgcgaggtcttcaggtcacattacaggataaatcttat
gaacaaattgcccctgcaatagggagagcgcataaactttatagtaaaaaattgcgtaag
ccgcgattgatccaggcagcaatggatagattaatcgcagatcccgaagggcatggggta
aaacgagcagatgtcattattgaggctgttttcgagaatttagccgttaaacaggaaata
atgaaaattgtggaaaaaaatgccaaaaaggatgcgatcatagcgacaaacacctctagt
atcccacttgatgaaatcagcagtgtaatgagtaaaccagagcgcttggtaggcattcat
ttctttaatcctgtagctaaaatggatttggtagaaatagtcagcagctcatctactgca
aaaaaaattcagcagagctcttgcgcgttcgtcaatcaaattggcaaattgcccttgcct
gtcaaatcaagccctgggtttttaataaacagagtactcatgccttacctgatggagtgc
gtacagttattggatgaaggatatagtgcggaaacaatagatgaggccgcattgcagttt
ggtatgtttatgggccctgttgaactggctgatacagtaggaatggatgtttgtcttgct
gtggccgaaaatctgaccagtcactttggtggcactattccacaaagattacgtgattta
gtaaaagaaggtaagctaggcagaaaaactggagaaggtttttataaatataaaaatgga
aaagtaattaagaaaaaagccccgtcacatgtcgataaaactattgcagacaggctaatt
ttacgcatggtgaatgaatctgcggcttgtatacgtgagaaagtggttgaagattctgac
ttgttggatgctgggatgatctttgccacaggttttgctccattccgtggagggcctatg
aattacgcaaatgattttggtaaagataaactggaaactttatttaaaacatttgaatct
aaatacggcgaacgttttaaggtagataccagcttataa

DBGET integrated database retrieval system