KEGG   Legionella pneumophila Paris: lpp1613Help
Entry
lpp1613           CDS       T00209                                 

Gene name
thrC
Definition
(GenBank) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00260  Glycine, serine and threonine metabolism
lpp00750  Vitamin B6 metabolism
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01120  Microbial metabolism in diverse environments
lpp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpp1613 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lpp1613 (thrC)
Enzymes [BR:lpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lpp1613 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N HBS1_N
Motif
Other DBs
NCBI-ProteinID: CAH12765
Pasteur: lpp1613
Position
complement(1799215..1800489)
Genome map
AA seq 424 aa AA seqDB search
MQMKIRIKSTRGQCVSTIDEAILSGLAGDGGLFVPDRFPNLTIKKFYEYGNLIDFSAHLL
SPFFSDSKIDVNNAFFQKFLTFSFPLHHLFKKSYVLELFHGPTLSFKDLGTQFFIECLLH
LIENKSAKVLVATSGDTGAAIAHALHGKRDLEGIILFPKDKLTFRQQSQITCWGENIRAL
AVNGSFDQCQQLVKLVFAKREHKGVLTTANSMNIARLLPQIIFYAFTSIQLALRHNHSVN
FIVPGGNLGNVTACYWAKMLGFPIEQILIANNTNSALGEFLLTGAYQAKSVTKTLATAMD
VGEPSNLERLFILFNNYPECRKQMNAESVSDEQIKQAILHCYNKYHYIICPHAATAYHRL
STINQDKSWVIVAPGHPAKFEEVLEPLLNKEIPVPEQLKVFLGRKQHYSIIEPNYHSLYH
FLVE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ctgcagatgaaaattagaataaagagtacgagaggacaatgtgtctccacaatagacgaa
gcaatactgtcaggcctggcaggggatggtgggttatttgtacctgacaggtttcctaat
ttaacaataaaaaaattttatgaatacggtaatttaatcgacttttctgctcatttactc
tcgccatttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctc
accttctcctttccgctacatcatctttttaagaaaagttatgtactggagttgtttcat
ggcccaaccctgtctttcaaagatttaggaactcaatttttcattgaatgtttattgcat
ctgatagaaaacaagagcgccaaagtcctggtcgcaacatctggtgatactggcgctgcg
attgctcatgctttgcatgggaaaagagatctggaaggaatcattttatttcccaaagat
aaacttactttcagacaacaatctcaaattacttgttggggagagaatattcgtgcattg
gctgttaatggcagctttgatcaatgtcaacagctggtgaagctggtatttgccaaaaga
gaacataaaggagtattgactacagccaatagcatgaatatagccagattattaccacag
attattttctatgcttttaccagcattcaactggcattaagacataatcattctgttaat
tttatagttccaggcggaaacctgggtaatgttacggcttgttattgggcaaaaatgctg
ggttttccgattgagcaaattttaatagctaataatactaatagtgcactgggcgaattt
ttgttaacgggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggat
gtaggtgagccaagcaatttggagcgtttattcattttatttaataattatcctgaatgt
agaaaacagatgaatgcagaatctgttagtgatgagcaaattaagcaagctatcctacat
tgttacaataaatatcattatataatttgccctcatgccgccacagcttatcatcgtcta
agtacaatcaatcaggacaaatcctgggttattgtggcaccagggcacccggccaaattt
gaagaggtattagaaccactattgaacaaagaaattcctgtcccggaacagctgaaggtc
tttttaggcagaaaacaacattattcaatcatagagccaaactatcattctttgtatcat
ttcttagttgaatga

DBGET integrated database retrieval system