KEGG   Legionella pneumophila Paris: lpp1613Help
Entry
lpp1613           CDS       T00209                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpp  Legionella pneumophila Paris
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lpp1613 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpp1613 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lpp1613 (thrC)
Enzymes [BR:lpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lpp1613 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1799215..1800489)
Genome map
AA seq 424 aa AA seqDB search
MQMKIRIKSTRGQCVSTIDEAILSGLAGDGGLFVPDRFPNLTIKKFYEYGNLIDFSAHLL
SPFFSDSKIDVNNAFFQKFLTFSFPLHHLFKKSYVLELFHGPTLSFKDLGTQFFIECLLH
LIENKSAKVLVATSGDTGAAIAHALHGKRDLEGIILFPKDKLTFRQQSQITCWGENIRAL
AVNGSFDQCQQLVKLVFAKREHKGVLTTANSMNIARLLPQIIFYAFTSIQLALRHNHSVN
FIVPGGNLGNVTACYWAKMLGFPIEQILIANNTNSALGEFLLTGAYQAKSVTKTLATAMD
VGEPSNLERLFILFNNYPECRKQMNAESVSDEQIKQAILHCYNKYHYIICPHAATAYHRL
STINQDKSWVIVAPGHPAKFEEVLEPLLNKEIPVPEQLKVFLGRKQHYSIIEPNYHSLYH
FLVE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ctgcagatgaaaattagaataaagagtacgagaggacaatgtgtctccacaatagacgaa
gcaatactgtcaggcctggcaggggatggtgggttatttgtacctgacaggtttcctaat
ttaacaataaaaaaattttatgaatacggtaatttaatcgacttttctgctcatttactc
tcgccatttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctc
accttctcctttccgctacatcatctttttaagaaaagttatgtactggagttgtttcat
ggcccaaccctgtctttcaaagatttaggaactcaatttttcattgaatgtttattgcat
ctgatagaaaacaagagcgccaaagtcctggtcgcaacatctggtgatactggcgctgcg
attgctcatgctttgcatgggaaaagagatctggaaggaatcattttatttcccaaagat
aaacttactttcagacaacaatctcaaattacttgttggggagagaatattcgtgcattg
gctgttaatggcagctttgatcaatgtcaacagctggtgaagctggtatttgccaaaaga
gaacataaaggagtattgactacagccaatagcatgaatatagccagattattaccacag
attattttctatgcttttaccagcattcaactggcattaagacataatcattctgttaat
tttatagttccaggcggaaacctgggtaatgttacggcttgttattgggcaaaaatgctg
ggttttccgattgagcaaattttaatagctaataatactaatagtgcactgggcgaattt
ttgttaacgggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggat
gtaggtgagccaagcaatttggagcgtttattcattttatttaataattatcctgaatgt
agaaaacagatgaatgcagaatctgttagtgatgagcaaattaagcaagctatcctacat
tgttacaataaatatcattatataatttgccctcatgccgccacagcttatcatcgtcta
agtacaatcaatcaggacaaatcctgggttattgtggcaccagggcacccggccaaattt
gaagaggtattagaaccactattgaacaaagaaattcctgtcccggaacagctgaaggtc
tttttaggcagaaaacaacattattcaatcatagagccaaactatcattctttgtatcat
ttcttagttgaatga

DBGET integrated database retrieval system