KEGG   Legionella pneumophila Paris: lpp1888Help
Entry
lpp1888           CDS       T00209                                 

Gene name
pfp
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lpp  Legionella pneumophila Paris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpp1888 (pfp)
   01230 Biosynthesis of amino acids
    lpp1888 (pfp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpp1888 (pfp)
   00030 Pentose phosphate pathway
    lpp1888 (pfp)
   00051 Fructose and mannose metabolism
    lpp1888 (pfp)
   00052 Galactose metabolism
    lpp1888 (pfp)
  Energy metabolism
   00680 Methane metabolism
    lpp1888 (pfp)
Enzymes [BR:lpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     lpp1888 (pfp)
Protein phosphatases and associated proteins [BR:lpp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     lpp1888 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2136034..2137278
Genome map
AA seq 414 aa AA seqDB search
MSVKNAIYAQSGGVTAVINASACGVIQTAKLFPEQIGKVYAAKNGIIGALNEELIDTSLE
SEEDIAKLMQTPSGAFGSCRYKLKDNGEEYQRLIAVFKAHNIGYFFYNGGGDSQDTAHKV
SQLGKTMGYPITCIGIPKTVDNDLPFTDNCPGFGSVAKYIAISTKEAGFDVASMAASSTK
VFILEVMGRHAGWIAAASGLAEQNPGEPPHIILLPEVPFEPTRFLKKVKDCVNSYGYCVI
VVSEGIRNKEGKFLSEAGLRDAFGHAQLGGVAPVIAQLIKSELGFKYHWAVADYLQRAAR
HIASQADLDQAYALGKAAVEYAVKGYNAIMPIVIREQDEPYQWSIGQVPLAEVANQEKAM
PPEYIAEDGMGITDACKRYLSPLIQGEAYPNYKNGLPDYVRLKNQLVAKKINQD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaatgcaatctacgcccagtctggtggtgtgaccgctgtaattaatgca
tcagcttgtggtgtcatccaaaccgccaaactatttccagagcaaattggtaaagtttat
gctgcaaaaaatggcattatcggtgccttaaacgaagagttaatcgatacttcattggaa
agtgaagaagacattgccaaattgatgcaaactccttctggggcttttggctcctgccgc
tacaaattaaaagacaatggggaagaatatcaacgcttaatcgctgtcttcaaggcccac
aacataggctatttcttttacaatggcggcggggactcacaagatactgcccataaagta
tcccagttaggtaaaaccatgggatatcctattacctgcataggtatccctaaaacagta
gataacgatctgccttttacagacaattgcccggggtttggatcagtcgcgaaatacatt
gccatttcaacaaaggaagctggttttgatgtcgcgtccatggcggcttcatccacgaaa
gtgtttattcttgaggtgatgggaaggcatgcaggctggatagcagcggctagtgggctg
gccgagcaaaatccaggcgaaccgccacacattattctattacctgaggttccttttgag
ccaactcgttttctaaaaaaagtgaaggactgtgtcaattcatatggttattgtgtgatt
gttgtttcagaaggtatccgcaataaggaaggaaaatttctcagtgaagcaggattacgt
gatgcattcggacatgctcaattaggtggtgttgcacctgtcatcgctcaattaattaaa
tctgaactgggttttaaatatcattgggcagttgcagattatcttcaacgggcagccaga
cacatagcctcgcaagctgatttagatcaagcttacgctttaggtaaagctgctgtggaa
tatgccgttaaaggatataacgcgattatgcctattgtcattcgtgaacaagacgaaccc
tatcaatggtctataggccaagtccctctggctgaggtagctaaccaggaaaaggctatg
ccaccagagtatatagctgaagatggcatgggaattacggacgcatgcaaacgttacttg
tcccctttgattcaaggtgaagcttatccaaattacaaaaatggattgccagattatgtc
cggctaaaaaaccagttagtggctaaaaaaatcaatcaagattaa

DBGET integrated database retrieval system