KEGG   Legionella pneumophila Paris: lpp1888Help
Entry
lpp1888           CDS       T00209                                 

Gene name
pfp
Definition
(GenBank) hypothetical protein
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
lpp  Legionella pneumophila Paris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpp1888 (pfp)
   00030 Pentose phosphate pathway
    lpp1888 (pfp)
   00051 Fructose and mannose metabolism
    lpp1888 (pfp)
   00052 Galactose metabolism
    lpp1888 (pfp)
  Energy metabolism
   00680 Methane metabolism
    lpp1888 (pfp)
Enzymes [BR:lpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     lpp1888 (pfp)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     lpp1888 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
Position
2136034..2137278
Genome map
AA seq 414 aa AA seqDB search
MSVKNAIYAQSGGVTAVINASACGVIQTAKLFPEQIGKVYAAKNGIIGALNEELIDTSLE
SEEDIAKLMQTPSGAFGSCRYKLKDNGEEYQRLIAVFKAHNIGYFFYNGGGDSQDTAHKV
SQLGKTMGYPITCIGIPKTVDNDLPFTDNCPGFGSVAKYIAISTKEAGFDVASMAASSTK
VFILEVMGRHAGWIAAASGLAEQNPGEPPHIILLPEVPFEPTRFLKKVKDCVNSYGYCVI
VVSEGIRNKEGKFLSEAGLRDAFGHAQLGGVAPVIAQLIKSELGFKYHWAVADYLQRAAR
HIASQADLDQAYALGKAAVEYAVKGYNAIMPIVIREQDEPYQWSIGQVPLAEVANQEKAM
PPEYIAEDGMGITDACKRYLSPLIQGEAYPNYKNGLPDYVRLKNQLVAKKINQD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaatgcaatctacgcccagtctggtggtgtgaccgctgtaattaatgca
tcagcttgtggtgtcatccaaaccgccaaactatttccagagcaaattggtaaagtttat
gctgcaaaaaatggcattatcggtgccttaaacgaagagttaatcgatacttcattggaa
agtgaagaagacattgccaaattgatgcaaactccttctggggcttttggctcctgccgc
tacaaattaaaagacaatggggaagaatatcaacgcttaatcgctgtcttcaaggcccac
aacataggctatttcttttacaatggcggcggggactcacaagatactgcccataaagta
tcccagttaggtaaaaccatgggatatcctattacctgcataggtatccctaaaacagta
gataacgatctgccttttacagacaattgcccggggtttggatcagtcgcgaaatacatt
gccatttcaacaaaggaagctggttttgatgtcgcgtccatggcggcttcatccacgaaa
gtgtttattcttgaggtgatgggaaggcatgcaggctggatagcagcggctagtgggctg
gccgagcaaaatccaggcgaaccgccacacattattctattacctgaggttccttttgag
ccaactcgttttctaaaaaaagtgaaggactgtgtcaattcatatggttattgtgtgatt
gttgtttcagaaggtatccgcaataaggaaggaaaatttctcagtgaagcaggattacgt
gatgcattcggacatgctcaattaggtggtgttgcacctgtcatcgctcaattaattaaa
tctgaactgggttttaaatatcattgggcagttgcagattatcttcaacgggcagccaga
cacatagcctcgcaagctgatttagatcaagcttacgctttaggtaaagctgctgtggaa
tatgccgttaaaggatataacgcgattatgcctattgtcattcgtgaacaagacgaaccc
tatcaatggtctataggccaagtccctctggctgaggtagctaaccaggaaaaggctatg
ccaccagagtatatagctgaagatggcatgggaattacggacgcatgcaaacgttacttg
tcccctttgattcaaggtgaagcttatccaaattacaaaaatggattgccagattatgtc
cggctaaaaaaccagttagtggctaaaaaaatcaatcaagattaa

DBGET integrated database retrieval system