KEGG   Legionella pneumophila Paris: lpp2264Help
Entry
lpp2264           CDS       T00209                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
lpp  Legionella pneumophila Paris
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    lpp2264
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    lpp2264
Enzymes [BR:lpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     lpp2264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2603871..2604653
Genome map
AA seq 260 aa AA seqDB search
MKLKNKVAIVTGAASGIGKEIALVYAKEGAKVAIADLNLDQASHVAEEIKSSGGQAMAVA
MNVTDEAQVNQGVDKVADHFGGVDVLVSNAGIQIIESVDKLAFSDWKRMLAIHLDGAFLT
TKACLKYMYASGNGGSIIYMGSVHSKEASVLKAPYVTAKHGLLGLCKVVAKEGGTHKVRA
NVICPGFVRTPLVDKQIPEQAKELGISEEDVIKKVMLKETVDGEFTTTDDVAQTALFFAS
FESNALTGQSLVVSHGWFME
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaagaataaagtcgctattgtcacaggagcagcaagcggaattggcaaagaa
attgcgcttgtttatgctaaagaaggggcaaaggtagcaatcgctgatctgaatcttgat
caggcaagccatgtagcagaggaaatcaaatcatcaggcggacaagcaatggctgttgcc
atgaatgtaactgatgaagcacaagtcaatcagggcgtggataaagtagctgatcacttt
ggaggagttgatgttttagtcagcaatgccggtattcaaatcatcgaatcagtggataaa
ttagccttttcagactggaaaagaatgcttgccattcatttggatggtgcctttttaact
actaaagcttgcttgaaatacatgtatgcctcaggcaatggcggcagtattatttatatg
ggctcggtccattccaaagaagcctctgtactcaaagcaccttatgttactgccaaacat
ggtctattgggtttatgcaaagtagttgccaaggaaggtggaactcataaggtaagagcc
aatgtcatttgcccgggatttgtccgtactcctctcgttgacaaacaaattccagagcaa
gcaaaagaattaggcatcagtgaagaagatgtcatcaagaaagtgatgctaaaagaaaca
gttgacggggaattcaccaccacagacgatgtagcacaaaccgctttattttttgcatca
tttgaatcgaatgcgcttacaggacaatcattggtagtcagtcatggttggttcatggag
taa

DBGET integrated database retrieval system