KEGG   Legionella pneumophila Paris: lpp2356Help
Entry
lpp2356           CDS       T00209                                 

Gene name
copA1
Definition
hypothetical protein
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
lpp  Legionella pneumophila Paris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2698228..2700438)
Genome map
AA seq 736 aa AA seqDB search
MKHDHHQGHTHSGKGHACPHEHNSPKTQQASSKMEGPIVYTCPMHPEIRQSAPGHCPLCG
MALEPETVTVSEVVSPEYLDMRRRFWIALMLTIPVVILEMGGHGLKHFISGNGSSWIQLL
LATPVVLWGGWPFFKRGWQSLKTGQLNMFTLIAMGIGVAWIYSMVAVLWPGVFPHAFRSQ
EGVVAVYFEAAAVITTLVLLGQVLELKAREQTGSAIRALLKLVPESAHRIKEDGSEEEVS
LDNVAVGDLLRVRPGEKIPVDGEVQEGRSFVDESMVTGEPIPVAKEASAKVIGATINQTG
SFVMKALHVGSDTMLARIVQMVSDAQRSRAPIQRLADTVSGWFVPAVILVAVLSFIVWAL
LGPQPALSYGLIAAVSVLIIACPCALGLATPMSIMVGVGKGAQSGVLIKNAEALERMEKV
NTLVVDKTGTLTEGHPKLTRIVTDDFVEDNALALAAALEHQSEHPLANAIVHAAKEKGLS
LGTVEAFEAPTGKGVVGQVDGHHVAIGNARLMQEHGSDNAPLFEKADELRGKGASVMFMA
VDGKTVALLVVEDPIKSSTPETILELQQSGIEIVMLTGDSKKTAEAVAGTLGIKKVVAEI
MPEDKSRIVSELKDKGLIVAMAGDGVNDAPALAKADIGIAMGTGTDVAIESAGVTLLHGD
LRGIAKARRLSENTMSNIRQNLFFAFIYNVLGVPLAAGVLYPLTGLLLSPMIAAAAMALS
SVSVIINALRLKRVTL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgaccaccatcaaggacatacccattctggtaaaggacatgcttgtcctcac
gaacataattctcccaagactcagcaagcctcttccaaaatggaggggcctattgtttat
acgtgtcccatgcacccagaaattcgccaatctgcccctggtcattgtcctctttgtggt
atggctttagaaccggaaacggtgacggtttcggaggttgtgagccctgaatatcttgat
atgagacgtcgattttggattgcattgatgttaactatacctgttgtgatattggagatg
ggtggacatggtttgaagcattttatttctggtaatggttccagttggatccaattgctt
cttgccacgccagtggtgttatggggaggttggccttttttcaagcgcggttggcagtct
ctaaaaacaggccaactcaatatgtttaccttgattgccatgggtattggtgtggcgtgg
atttacagtatggtggctgtcctttggccaggtgtatttccccatgcgtttcgaagtcaa
gaaggagtagttgctgtttattttgaagcggcagcagtgattactacgcttgtcttgttg
gggcaagtgctggaactaaaagctcgagaacaaacgggtagtgccatccgtgccttgtta
aaattggtccctgaaagtgcacaccgaattaaggaagatggcagtgaagaggaagtgtcc
ctggataacgttgccgttggtgatttgttgcgtgttcggcctggtgaaaaaataccagtg
gatggtgaagtgcaagaaggccgaagctttgtcgatgaatccatggtgacgggtgagccc
attccagttgctaaagaggccagcgctaaagttattggtgctacgattaatcagacgggt
agctttgtcatgaaagcgctgcatgtgggcagtgataccatgcttgcacgcattgtgcag
atggtgagtgatgcccaacgaagccgtgcgccgattcagcgactagccgataccgtctca
ggatggtttgtgcccgctgtgattttggttgcggtgctgtcttttattgtgtgggcactg
ttgggtccgcaaccagcgcttagctatggtttaatcgctgctgtgtcagtactcatcatc
gcttgcccttgtgcgttaggtttagcaacgcccatgtccattatggtcggtgttggaaaa
ggagcacaaagcggggtattgattaaaaatgccgaagcgttggaacgaatggagaaggtc
aataccctggtggtcgataaaacgggcacgcttactgaaggtcaccctaaattgacacgc
attgtgaccgatgatttcgtggaggataatgctttagcattagctgcggcacttgagcat
caaagtgaacatccgctggccaatgctattgtgcatgctgcaaaagaaaaaggattgtcc
cttggaacagtcgaagcgtttgaagcgcccactggaaaaggggttgtaggtcaggtagac
ggccatcatgttgctattggtaacgccagattaatgcaagagcatggaagcgataatgcc
cctctttttgaaaaggctgatgaacttcgtggtaaaggcgcctcagtcatgtttatggcg
gttgatggtaaaacagtagctctcttggtggttgaagaccctattaaatcgagtactcca
gagaccatcctcgaacttcagcaaagtggcattgaaattgtcatgctcaccggagatagc
aaaaaaacagcagaagcggtggcagggaccctcggcattaaaaaggtggtagctgaaatc
atgcctgaagacaagagtcgcatcgtgagtgaattaaaagacaaaggtcttattgttgcc
atggcaggagatggggtgaatgatgccccagcgcttgccaaagctgatattggtattgcc
atgggaacaggcactgatgtggccatcgaaagtgctggggtcaccttgttgcatggagat
ttgcgtggtatcgccaaagcgcgacgtttgtcagaaaataccatgagcaacattcgccaa
aatcttttcttcgcctttatttataatgtactgggtgtgcctttggctgctggggttttg
taccccctaaccggcttgctcttaagtcctatgattgcagcagcggcgatggcgctttct
tcagtgtcagtgattatcaatgcgctgagactaaagagagtgacactatga

DBGET integrated database retrieval system