KEGG   Legionella pneumophila Paris: lpp2558Help
Entry
lpp2558           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00010  Glycolysis / Gluconeogenesis
lpp00071  Fatty acid degradation
lpp00350  Tyrosine metabolism
lpp00625  Chloroalkane and chloroalkene degradation
lpp00626  Naphthalene degradation
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01120  Microbial metabolism in diverse environments
lpp01130  Biosynthesis of antibiotics
lpp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpp2558
  Lipid metabolism
   00071 Fatty acid degradation
    lpp2558
  Amino acid metabolism
   00350 Tyrosine metabolism
    lpp2558
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lpp2558
   00626 Naphthalene degradation
    lpp2558
Enzymes [BR:lpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     lpp2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CAH13711
Pasteur: lpp2558
Position
2911010..2911996
Genome map
AA seq 328 aa AA seqDB search
MHAMIMEKPGCALQYQEVNKPNPNENELLIKVSACGICRTDLHVVDGELKNPKTPLIPGH
QIVGTVEQVGSAVKKFAIGQRVGVPWLGGSCGICNFCTSGRENLCDQACFTGYQIDGGFA
EFCVANYHFCFPIPDGYPDHQAAPLFCAGLIGYRALLKAGNATHLGLYGFGAAAHILIQV
ACQKGIKIYAFTSPGDQETQKFAYRLGAVWAGDSTQSPPHLLDAAIIFAPVGALVPQALH
NTVKGGTVVCAGIHMSDIPSFPYEILWGERTVCSIANLTRKDGEEFLSLAPKIPVKTKVQ
TYPLTEVNRALDDLRHGRYRGAGVIVMK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcatgctatgatcatggaaaagcctggatgtgcattgcaatatcaggaagtcaataaa
ccaaatccaaatgaaaatgaacttttaattaaagtatcagcttgtgggatttgtagaact
gacttgcatgttgtcgatggtgagctgaaaaatcccaagactccccttattccaggccac
caaattgtaggaactgttgagcaggttggatccgctgtaaagaaatttgcaattggacag
cgagttggagtcccttggctaggtggaagttgcgggatctgtaatttttgcacctctggc
cgagaaaatttatgtgatcaagcctgctttaccgggtatcaaatagatggtggtttcgct
gagttctgtgtagcaaattaccatttttgcttccctattcctgatggatacccggatcat
caggcagcaccattattttgtgctggtttaattggatatcgtgccttgctaaaggctggt
aacgcaactcatttaggcctatatggatttggagcggcagcacatatactgattcaagta
gcttgccaaaaaggaataaaaatttatgcgtttacaagcccaggtgatcaggaaactcaa
aaatttgcataccgattaggtgctgtctgggccggagattctacgcaatcaccacctcat
cttcttgatgcagcaatcatttttgcacccgttggtgcattagtgcctcaggctcttcac
aatactgtaaaaggaggtactgtggtttgtgctggtatacatatgtcggatattcccagc
tttccttatgaaatactgtggggtgaacgcactgtatgttcaattgccaatctaactcgc
aaagatggagaagagttcctgtctctggcccctaaaatcccagttaagacaaaagttcaa
acctatccccttactgaagttaatcgagcactggatgatttaagacatggcaggtataga
ggagccggggttattgttatgaaataa

DBGET integrated database retrieval system