KEGG   Legionella pneumophila Paris: lpp2685Help
Entry
lpp2685           CDS       T00209                                 

Gene name
holC
Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lpp  Legionella pneumophila Paris
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lpp2685 (holC)
   00240 Pyrimidine metabolism
    lpp2685 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    lpp2685 (holC)
   03430 Mismatch repair
    lpp2685 (holC)
   03440 Homologous recombination
    lpp2685 (holC)
Enzymes [BR:lpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     lpp2685 (holC)
DNA replication proteins [BR:lpp03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     lpp2685 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3061195..3061629
Genome map
AA seq 144 aa AA seqDB search
MSPIRVDFYLLASSLPESRWLVACRLIEKAYIKGHTIFVFCDNQQQAEYLDELLWTFKDD
SFIPHNLQGEGPEPPPPVQIGYQKEPRGFTDILLNLSTNIPIFYTRFKRVIELVSNVEHE
KEVSRLHYKEYRYKGCALHTHSIE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaattcgcgttgatttttacttattagccagcagccttccagaatctcgctgg
ttggttgcttgtcgtttaatagaaaaagcctatatcaaaggacatactatttttgttttt
tgcgacaatcagcaacaagcagaataccttgatgaattattgtggactttcaaagacgac
agttttattcctcataatttgcaaggtgaaggaccagaacctcctcctcccgtacaaatt
ggctatcaaaaagaacccagaggctttacagatatcctgttgaatttatccaccaatatt
ccaattttttatacccgatttaaaagagtcattgaattggtgagtaatgtagaacatgag
aaagaagtgagtagattgcactataaagaatataggtataaaggatgtgcattgcacaca
cactcgattgaataa

DBGET integrated database retrieval system