KEGG   Legionella pneumophila Paris: lpp2745Help
Entry
lpp2745           CDS       T00209                                 

Definition
hypothetical protein
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
lpp  Legionella pneumophila Paris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3129165..3131708
Genome map
AA seq 847 aa AA seqDB search
MSKPYYFYVSGMNCTSCSNAIESFLRNSNLIKINTFHADMSTPDPKKIVISLSEEKENEH
ESNWKTIKKLIDDTGFTCENYEFPQVRDQKPALPLEKTQTTVQQEASQLSALFSSAKKII
TSHWLLGGLGCITGVSLMILTMALGGLPLAVMIPLASISTLLTIALGAQSYYEAWKKLVQ
SRTLTMDTLFSISTISVLVVSLASFFVPWLPMMFEAGLLIYGFRHIGIAIEDTIKDKISS
AKFQDRAPQKVRLYRHPDFKKTRIDEIQPNDIIQVKPGELIPLDSVCEQDTLIYPTIITG
AVIPKQFRSGEKILAGMRLANDAKPLSLRVLKTAKESYLARLDESIAQSVLEKAPIEVKT
GQLLSYFIPSIIALSILSGIIVGLIATPALAIQCAISVLVSACPCTLGLIIPLAVKTGIH
KGAEHGVQFKNSRVLQLAEQIDVVIFDLNGTLTTGVPVVKEYAVLNDADLSSEQFLSICN
VLEEQSKHPFGKAIQSFTQGINKQKFNIANLDHSNHSGVSAEINGIQYTIGSKTLMQEIG
ISTFSLENQMNLVAGDSLVFLARNKQLLGYLVITDPLRKDAKQTVDALIKMGKEVHLCTG
ADEKTAYRYAQALGIKKVHANCVATTINTEDRSKPVYIKSLQNQGLKVAMIGDAANDANA
LAASDFGIAVLSQDSDEITQQHASAIIQSGTILPIANAFAISKQTVNNINQNLLISLGYN
LTTVLIAGGLLVALGFVLNPAVGVALMVTQACFVLLNVYRFKEQPLQHLQDKVQEKPEPA
PSSYEAMKKHSPNFHTAPEINHSQAIQSGKQPTNKNKSPSFWSDYFPELFEEEKDTSTEH
LMNNKIG
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaccttattatttttatgtcagcggaatgaattgcaccagttgcagtaatgcc
atagagtcctttttaagaaattccaatttaatcaaaatcaatacatttcacgcggacatg
agcaccccggatccaaaaaaaattgtgatatctctttctgaagaaaaggaaaatgaacat
gaaagcaactggaaaaccattaaaaaattaattgatgatacaggttttacttgcgaaaat
tatgaattccctcaggtgagagatcaaaaacctgctcttcctctcgagaaaacgcagaca
accgttcaacaggaagccagccaattatccgcactctttagcagcgcaaaaaaaataatc
acctcccattggttgcttggaggattgggttgtatcactggggttagcttaatgatcctg
actatggctctaggtggtttaccacttgcggtaatgatccctttagcaagcatcagcact
ttattaactattgcgcttggtgcccaatcttattacgaggcttggaaaaaattagtccaa
tctcgcacactcacaatggacacattattttcaattagcactatttctgttcttgttgtg
tcgcttgcttcattctttgtaccatggttgcctatgatgtttgaggcaggattacttatt
tatggattcaggcatattggtatcgctattgaggacactatcaaagacaaaataagctcc
gccaaatttcaagacagagccccgcaaaaagtcagattatatcgccatcctgactttaaa
aaaacgaggattgatgagattcaacccaacgacattatacaagtcaaaccgggtgagctt
ataccattggatagcgtttgtgagcaagacaccctcatttatcccaccatcattaccggt
gctgtcatacctaaacaatttcgtagtggtgaaaaaatacttgccggaatgcgtctggca
aatgatgcaaaaccactcagcctccgcgttctaaaaactgcaaaagagtcataccttgcc
cgtcttgatgaaagcatagctcaatctgtacttgaaaaagcaccgatagaggtaaaaaca
gggcagcttcttagctattttatcccatccattattgctctctccatcctttcagggatc
attgtcggcttgattgccacaccagcacttgcgatacaatgcgctatttcagtattggtt
tctgcttgtccttgtacgcttggtttaattattcctctagcagtaaaaactggaattcat
aaaggagccgaacacggtgtgcagtttaaaaattccagggtattacaattagcagaacaa
attgatgtagtcatttttgacttgaatggtacgttaacaaccggcgttcctgtggttaaa
gaatatgctgtattaaatgatgctgatctttcttctgagcaatttctgagtatttgcaat
gtgttggaagaacaatcaaaacaccctttcggcaaagcaatacaatcgtttacccaagga
atcaataaacaaaaattcaatattgctaatttggatcattcgaaccattcaggcgtttca
gcagagattaatggtattcaatatactattggcagtaaaaccttaatgcaggaaataggg
atttctacattttcgcttgaaaaccaaatgaatctggttgcgggcgatagcctagtgttt
ctagccagaaacaaacaactattaggttatctggtcatcaccgaccccttacgaaaagat
gcaaagcaaacagttgatgctttaattaaaatgggaaaagaagtgcatctatgcactggt
gcagatgaaaaaaccgcctatcgctatgcgcaagctcttggcattaagaaggtacatgct
aattgtgtcgctacaactatcaatacagaggatagatccaaaccggtttatattaaatca
ttacaaaatcagggactaaaagtagctatgattggagatgcggctaatgacgcaaacgcc
cttgctgctagtgacttcggtatagctgtactgtctcaagacagcgatgaaatcacccag
caacacgcctcagccattatacaaagtggaactatattgcctatagccaatgcctttgcc
atatcaaaacaaacagtaaacaatatcaaccagaatttgttaattagcttagggtacaat
ttgacaacagtattaatagccggcggtctgctagtcgcccttggttttgtgctaaaccct
gctgttggtgtggcattaatggtaacccaggcttgttttgtcttgctcaatgtataccgc
tttaaagagcaacccttgcaacatttgcaagacaaagttcaggaaaaaccagaaccggct
ccttcttcttatgaggccatgaaaaagcattcacccaatttccatacagctcccgagatt
aatcattcgcaagccattcaatctggaaagcaaccaaccaataaaaataaatcaccttcc
ttttggagtgattattttcctgaattatttgaggaagaaaaggacacaagtaccgaacac
ctaatgaataacaaaataggataa

DBGET integrated database retrieval system