KEGG   Legionella pneumophila Paris: lpp2804Help
Entry
lpp2804           CDS       T00209                                 

Gene name
recR
Definition
(GenBank) Recombination and repair protein recR
  KO
K06187  recombination protein RecR
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpp2804 (recR)
DNA repair and recombination proteins [BR:lpp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     lpp2804 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      lpp2804 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim CoA_binding_3 HHH_5 HHH FlhC
Motif
Other DBs
NCBI-ProteinID: CAH13957
Pasteur: lpp2804
UniProt: Q5X1D9
Position
3192601..3193194
Genome map
AA seq 197 aa AA seqDB search
MDALSRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMKHISHCQQCNNY
TEQTLCTLCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLDGLGPDDIG
LPKLKELIIREKIQEVILALSPSVESQTTIHFIHQLLKDETVNISQLAHGIPSGGELEFL
DGNTISSALKNRAVINV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctaagccgcttggtagaggcgcttcgctgtcttcccggtgtgggaccaaaa
tcagcacaaaggatggtgttccatttattgcagcaccaaagacagcgaggtttacacctt
gcctcctgtttggaacaggcaatgaagcacattagtcattgtcagcagtgtaataattac
accgaacaaactctgtgtactctttgccaaaaccccaatcgagattcaacattactttgc
gtggtagagagtccagcggatgtttctgccatagaacaaagcaattcctttcaaggtaaa
tattttgtccttatgggaaaaatttctcctcttgatggtttgggacctgatgacataggg
ctaccgaaacttaaggagttaattattagggaaaaaattcaggaagttattcttgcatta
agccccagtgttgaaagccagaccacaattcattttattcatcagttgctaaaggatgaa
actgtcaatatcagtcagttagcacatggaataccatcaggtggtgaattagaattttta
gatgggaatactataagcagtgcccttaagaacagagcagtgattaatgtctaa

DBGET integrated database retrieval system