KEGG   Legionella pneumophila Paris: lpp2804Help
Entry
lpp2804           CDS       T00209                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lpp  Legionella pneumophila Paris
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpp2804 (recR)
DNA repair and recombination proteins [BR:lpp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      lpp2804 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3192601..3193194
Genome map
AA seq 197 aa AA seqDB search
MDALSRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMKHISHCQQCNNY
TEQTLCTLCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLDGLGPDDIG
LPKLKELIIREKIQEVILALSPSVESQTTIHFIHQLLKDETVNISQLAHGIPSGGELEFL
DGNTISSALKNRAVINV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctaagccgcttggtagaggcgcttcgctgtcttcccggtgtgggaccaaaa
tcagcacaaaggatggtgttccatttattgcagcaccaaagacagcgaggtttacacctt
gcctcctgtttggaacaggcaatgaagcacattagtcattgtcagcagtgtaataattac
accgaacaaactctgtgtactctttgccaaaaccccaatcgagattcaacattactttgc
gtggtagagagtccagcggatgtttctgccatagaacaaagcaattcctttcaaggtaaa
tattttgtccttatgggaaaaatttctcctcttgatggtttgggacctgatgacataggg
ctaccgaaacttaaggagttaattattagggaaaaaattcaggaagttattcttgcatta
agccccagtgttgaaagccagaccacaattcattttattcatcagttgctaaaggatgaa
actgtcaatatcagtcagttagcacatggaataccatcaggtggtgaattagaattttta
gatgggaatactataagcagtgcccttaagaacagagcagtgattaatgtctaa

DBGET integrated database retrieval system