KEGG   Legionella pneumophila Paris: lpp2814Help
Entry
lpp2814           CDS       T00209                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lpp  Legionella pneumophila Paris
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lpp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3203479..3204018
Genome map
AA seq 179 aa AA seqDB search
MEKLYSNLLKELGEDINREGLKDTPGRAANALRYLTKGYNENLDEIINGALFDSDMSEMV
IVKDIELYSLCEHHLLPFLGKCHVGYLPDGKVIGLSKIARIVDFYARRLQIQERLTGEIA
HCIESITGARGVAVVIEAKHLCMMMRGVEKQNSVMTTSVMLGEMRNNSSCRLEFLNLIR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattatactcaaatttgcttaaagaattaggcgaagatataaatagggaagga
ttaaaggatactcctggacgagcagctaatgccttacgttatttaactaaaggttacaat
gagaaccttgatgaaatcattaacggtgctctgtttgattcagacatgagtgaaatggtt
atcgtcaaggacatagaactgtactcattatgcgaacatcacttattgccttttttgggc
aaatgtcatgttggatatctacctgatggtaaagtaataggcttatctaaaattgctcgt
attgttgatttttatgcgaggagactacaaattcaagaacggctgactggcgaaattgct
cattgtattgaatccattaccggagctcgcggtgtcgccgtagtgattgaagcaaaacat
ctttgcatgatgatgcgtggagttgaaaaacaaaattctgtcatgacaacttcagttatg
ctcggtgaaatgcgtaacaattcgagttgccgtttggaattcttaaatttaatccgttaa

DBGET integrated database retrieval system