KEGG   Legionella pneumophila Paris: lpp2838Help
Entry
lpp2838           CDS       T00209                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lpp  Legionella pneumophila Paris
Pathway
lpp00010  Glycolysis / Gluconeogenesis
lpp00051  Fructose and mannose metabolism
lpp00562  Inositol phosphate metabolism
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01120  Microbial metabolism in diverse environments
lpp01130  Biosynthesis of antibiotics
lpp01200  Carbon metabolism
lpp01230  Biosynthesis of amino acids
Module
lpp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpp2838 (tpi)
   00051 Fructose and mannose metabolism
    lpp2838 (tpi)
   00562 Inositol phosphate metabolism
    lpp2838 (tpi)
Enzymes [BR:lpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lpp2838 (tpi)
Exosome [BR:lpp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lpp2838 (tpi)
  Exosomal proteins of bladder cancer cells
   lpp2838 (tpi)
  Exosomal proteins of melanoma cells
   lpp2838 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAH13991
Pasteur: lpp2838
UniProt: Q5X1A5
Position
complement(3229480..3230229)
Genome map
AA seq 249 aa AA seqDB search
MRQKIVAGNWKMNGQIQQVTELVSQIEELIGFDCAAQVAVMPPSIYIPKVRDCLKTGKVV
VGAQNVYPKDYGAYTGELSAPMLKDFDCRYVLVGHSERRQFFHEDENFVAQKFHHVKDHG
MIPILCVGETLSERENGKTEQVIAQQVLAVSAKGKDCFRDCVVAYEPVWAIGTGKTATPE
QAQKIHQFIRDLVGEINDSDAKHLTLIYGGSVNENNAKALFSMPDIDGGLVGGASLNAKQ
FVEIVKCIN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaaaagatagttgctggtaactggaaaatgaatggccagattcaacaggtgact
gaattggtttcgcaaattgaggaattaattggctttgattgcgcagcacaggttgctgta
atgcctcccagcatttatatacccaaggtaagagactgcttaaagacggggaaggttgta
gtaggtgcgcaaaatgtttatccaaaagattatggtgcctacacaggtgaactgtcagct
cccatgcttaaagattttgattgccgatatgttctggtggggcactcggagcgcaggcaa
ttttttcatgaagatgaaaattttgtggcgcaaaaattccaccatgtaaaagatcatggt
atgatacctattctttgtgttggtgaaactctttctgaaagagagaatggaaaaacagag
caggttattgctcaacaggtgctcgcagtgagtgcaaaagggaaagattgttttcgtgat
tgcgtagtggcttatgagcctgtatgggcaattgggacaggaaaaactgctacacctgaa
caggcacaaaaaatacaccagtttattagagatctggttggagaaataaatgatagcgat
gcgaaacatttgacgctcatatatggtggcagtgttaatgaaaataatgcaaaagcctta
ttttccatgccagatattgatggagggttagtgggtggagcatcgttgaatgcaaaacaa
tttgtggaaattgtgaaatgtatcaactga

DBGET integrated database retrieval system