KEGG   Legionella pneumophila Paris: lpp2893Help
Entry
lpp2893           CDS       T00209                                 

Gene name
glmS
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
lpp  Legionella pneumophila Paris
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    lpp2893 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lpp2893 (glmS)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    lpp2893 (glmS)
Enzymes [BR:lpp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     lpp2893 (glmS)
Peptidases [BR:lpp01002]
 Cysteine Peptidases
  Family C44
   lpp2893 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3304270..3306084)
Genome map
AA seq 604 aa AA seqDB search
MCGIMGAVSERDISKILLEGLRRLEYRGYDSAGIAVIDSQDRLKRVRIQGKVQNLADAMQ
ETAIAGNTGIAHTRWATHGKPSEQNAHPHLSHGEIALVHNGIIENHEHLRQQLITYGYQF
TSETDTEVAAHLIHYHYQQHENLLLAVQKAAAEMQGAFALGVIHQKRPEELVAIRKGSPL
VLGFGIGENFIASDALALRSFAQSVIYMEEGDSACVTTQDIKVYDSNRILVQRAVHPLNS
DSEIVNKGPYRHFMLKEIFEQSKVITDTLESRINSIDVLRASFGEKASHIFPMVKNIHIV
ACGTSYHAGMIAKYWLESLAGLPTQVEIASEYRYRDVVVPDNTLFITVSQSGETADTLAA
LFKAKQSNYLASLAICNVATSTLVREADCVFLTRAGIEIGVASTKAFTTQLAAFLMLAAA
LCKDNRAQEVLRQLQELPACCERVLQMNEEVESLASLFVNKVHALFLGRGVQYPVALEGA
LKLKEISYIHAEAYPAGELKHGPLALVDKDMPVIAVAPNDELLDKLKSNLHEVSARGGQL
FVFVDDSQNWKANGARLIKVPSCGAWLAPIVYTIPLQLLAYHVAVAKGTDVDQPRNLAKS
VTVE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattatgggagctgtttcagaacgggatattagcaagattttattggaaggc
ttgcgccgattggaatatagagggtacgattctgcaggtattgctgtcatagatagtcaa
gatcgtttaaagagagtaagaatccaggggaaagtgcagaatttggcggatgctatgcaa
gagaccgctatcgctggaaatacaggtatagctcatactcgttgggcgacgcatggtaaa
ccctccgaacaaaatgctcatcctcatttatctcatggagaaatcgcattagttcacaat
ggcattattgaaaatcatgaacatttgcgtcaacaacttattacttatggctatcaattc
acatctgaaactgatacagaggttgctgcgcatttaattcattatcattaccagcagcat
gagaatttattacttgctgtacaaaaagctgctgcagaaatgcaaggggcttttgcatta
ggagtgattcatcagaaaagaccagaagaattggttgcaattcgtaaagggagtcctttg
gttttgggatttggaattggtgagaatttcattgcatcggatgctttggcactaagatct
ttcgcacaatcagttatttacatggaagagggtgacagtgcttgtgtcacaacacaggat
attaaggtttatgattccaatcgaatacttgttcaaagagcggttcatccgttgaacagt
gattctgagatagtgaataaagggccatacaggcattttatgctgaaagaaatatttgaa
caatcgaaggtaatcacagacacgttagaaagtcgaattaatagcattgatgtgctaaga
gcaagttttggtgagaaagcatcccatattttcccaatggtaaaaaatattcacattgtg
gcatgtggaaccagttatcatgctggaatgattgccaaatattggcttgaatcacttgcc
ggcttacctacacaggttgaaattgcaagtgaatatcgataccgagatgttgttgtcccc
gacaataccttatttatcactgtatctcagtcaggagaaacagctgatactcttgctgcc
ctatttaaggcaaagcaatcgaattatttggctagtttagctatatgcaatgttgcaacc
agtactttagtgagagaggcggattgtgtttttttaactcgggcaggtattgagattggt
gtagcatctaccaaagcgtttactacacagttggcagccttcctgatgttggcagcagca
ctttgtaaggacaatcgcgcgcaggaagttttaagacaattacaagagctgcctgcctgt
tgtgagcgtgttttgcagatgaatgaagaagtcgaatcattggcttctttgtttgtaaat
aaagttcatgccttatttttaggtcgaggggttcaatatcccgtagccctggaaggcgca
ttaaaacttaaggaaatatcttatatacatgcggaagcttatcctgccggtgaattaaag
catggtccattggctttggttgataaggatatgcctgtgattgcagtagcccctaatgat
gaacttttagataaattaaaatccaatttacatgaagtgagcgccagaggtgggcagtta
tttgtatttgttgatgattcacaaaattggaaagcgaatggtgctcgtttaatcaaagtt
ccatcctgtggtgcttggcttgcgcctattgtttacactattcctttgcaattgctggcc
tatcatgttgctgtagctaaagggactgatgtggatcaacctagaaaccttgcaaaatcg
gtgactgtggagtga

DBGET integrated database retrieval system