KEGG   Legionella pneumophila Paris: lpp2893Help
Entry
lpp2893           CDS       T00209                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
lpp  Legionella pneumophila Paris
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lpp00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lpp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3304270..3306084)
Genome map
AA seq 604 aa AA seqDB search
MCGIMGAVSERDISKILLEGLRRLEYRGYDSAGIAVIDSQDRLKRVRIQGKVQNLADAMQ
ETAIAGNTGIAHTRWATHGKPSEQNAHPHLSHGEIALVHNGIIENHEHLRQQLITYGYQF
TSETDTEVAAHLIHYHYQQHENLLLAVQKAAAEMQGAFALGVIHQKRPEELVAIRKGSPL
VLGFGIGENFIASDALALRSFAQSVIYMEEGDSACVTTQDIKVYDSNRILVQRAVHPLNS
DSEIVNKGPYRHFMLKEIFEQSKVITDTLESRINSIDVLRASFGEKASHIFPMVKNIHIV
ACGTSYHAGMIAKYWLESLAGLPTQVEIASEYRYRDVVVPDNTLFITVSQSGETADTLAA
LFKAKQSNYLASLAICNVATSTLVREADCVFLTRAGIEIGVASTKAFTTQLAAFLMLAAA
LCKDNRAQEVLRQLQELPACCERVLQMNEEVESLASLFVNKVHALFLGRGVQYPVALEGA
LKLKEISYIHAEAYPAGELKHGPLALVDKDMPVIAVAPNDELLDKLKSNLHEVSARGGQL
FVFVDDSQNWKANGARLIKVPSCGAWLAPIVYTIPLQLLAYHVAVAKGTDVDQPRNLAKS
VTVE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattatgggagctgtttcagaacgggatattagcaagattttattggaaggc
ttgcgccgattggaatatagagggtacgattctgcaggtattgctgtcatagatagtcaa
gatcgtttaaagagagtaagaatccaggggaaagtgcagaatttggcggatgctatgcaa
gagaccgctatcgctggaaatacaggtatagctcatactcgttgggcgacgcatggtaaa
ccctccgaacaaaatgctcatcctcatttatctcatggagaaatcgcattagttcacaat
ggcattattgaaaatcatgaacatttgcgtcaacaacttattacttatggctatcaattc
acatctgaaactgatacagaggttgctgcgcatttaattcattatcattaccagcagcat
gagaatttattacttgctgtacaaaaagctgctgcagaaatgcaaggggcttttgcatta
ggagtgattcatcagaaaagaccagaagaattggttgcaattcgtaaagggagtcctttg
gttttgggatttggaattggtgagaatttcattgcatcggatgctttggcactaagatct
ttcgcacaatcagttatttacatggaagagggtgacagtgcttgtgtcacaacacaggat
attaaggtttatgattccaatcgaatacttgttcaaagagcggttcatccgttgaacagt
gattctgagatagtgaataaagggccatacaggcattttatgctgaaagaaatatttgaa
caatcgaaggtaatcacagacacgttagaaagtcgaattaatagcattgatgtgctaaga
gcaagttttggtgagaaagcatcccatattttcccaatggtaaaaaatattcacattgtg
gcatgtggaaccagttatcatgctggaatgattgccaaatattggcttgaatcacttgcc
ggcttacctacacaggttgaaattgcaagtgaatatcgataccgagatgttgttgtcccc
gacaataccttatttatcactgtatctcagtcaggagaaacagctgatactcttgctgcc
ctatttaaggcaaagcaatcgaattatttggctagtttagctatatgcaatgttgcaacc
agtactttagtgagagaggcggattgtgtttttttaactcgggcaggtattgagattggt
gtagcatctaccaaagcgtttactacacagttggcagccttcctgatgttggcagcagca
ctttgtaaggacaatcgcgcgcaggaagttttaagacaattacaagagctgcctgcctgt
tgtgagcgtgttttgcagatgaatgaagaagtcgaatcattggcttctttgtttgtaaat
aaagttcatgccttatttttaggtcgaggggttcaatatcccgtagccctggaaggcgca
ttaaaacttaaggaaatatcttatatacatgcggaagcttatcctgccggtgaattaaag
catggtccattggctttggttgataaggatatgcctgtgattgcagtagcccctaatgat
gaacttttagataaattaaaatccaatttacatgaagtgagcgccagaggtgggcagtta
tttgtatttgttgatgattcacaaaattggaaagcgaatggtgctcgtttaatcaaagtt
ccatcctgtggtgcttggcttgcgcctattgtttacactattcctttgcaattgctggcc
tatcatgttgctgtagctaaagggactgatgtggatcaacctagaaaccttgcaaaatcg
gtgactgtggagtga

DBGET integrated database retrieval system