KEGG   Legionella pneumophila Paris: lpp2904Help
Entry
lpp2904           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
lpp  Legionella pneumophila Paris
Brite
Enzymes [BR:lpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     lpp2904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 UPF0227 Abhydrolase_6 Abhydrolase_1
Motif
Other DBs
NCBI-ProteinID: CAH14057
Pasteur: lpp2904
Position
3317220..3317981
Genome map
AA seq 253 aa AA seqDB search
MRRGKHLSELQSEEANLLAPVNQRGKGTERALLVLHGFSSSPAVYRYLIPNLKNYDAILC
PVLAGHAESIEAFSKSKAADWLQSAKNACELLINQYQKVDVLGLSLGGLLACQLSQSFAI
NHLFLLAPALKLHMRINGMLKLAQILKCLGFRQLRNAAGNLITDEHAEIAYRKLPISTII
EMLTLAQQYKWLPPACSADLFLGIHDQVVASQQVEQLFCNLPNVKIHWLENSAHVLPLDN
DLNEIIDCINKSK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcggcaaacatctcagtgaactgcagtcggaggaagcaaatctccttgctcca
gtcaatcagcgtggtaaaggcacagaacgagctttactggtattgcatggtttctcttct
tcaccggcagtttaccgatatctgattcctaatttaaaaaattatgatgccatcctttgc
cctgtattggctggtcacgccgaaagtatagaagccttttcaaaatccaaagcagctgat
tggcttcaatcagcaaaaaacgcctgtgaactcttaataaatcaatatcaaaaagttgat
gttttagggttatctctgggaggattattagcctgtcaattaagtcaatcctttgctatc
aatcacctgtttctattagctcccgcgttaaaattacacatgcgcatcaacggcatgctg
aaattagcccagattcttaagtgcctgggatttcgacaacttcgcaacgccgcagggaat
cttatcaccgatgagcatgctgaaatcgcttatagaaaactaccgatttctacaataatt
gaaatgctaaccttggctcagcaatataaatggctccctcctgcttgctcggccgatctt
tttcttggaattcatgatcaagtggttgcttctcaacaagtagaacaattattttgtaat
ttacctaatgtaaaaatacattggttagaaaattccgcgcatgtattgccactggacaat
gatctgaatgaaattattgattgtattaataaaagtaagtga

DBGET integrated database retrieval system