KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0014Help
Entry
LBP_cg0014        CDS       T02670                                 

Definition
(GenBank) Transport protein
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
15370..16593
Genome map
AA seq 407 aa AA seqDB search
MAQKQLIKTPWLIAGQFMNNIGMSFIWPLTTIYMHNVLGKSLTETGIVLMLNSVANVLAS
TIGGRIFDRGNPYHLLLMGITLNGLANFALIFFHGWPWYPMLLVVTGFASGWLNTMFNAL
AASVPRDKVRRTFTLMYLAANLGVVFGTMLVGIVYSMGMALLFSMTTSLFVIFLIIALFE
YNVDSSNVTGVDPRQGQDVHLPRANFHIVWTFFISLFIIWLLYEQWVSNLSVYMTNLGMP
LRNYSFLWTINAGLLVLIQSILSLLGNRIKNLYNQFFFGMLFVGLSFLSLVIAHDYPHFI
FAMILLTIGEATWSPAMPTLVSQLSPVSAKGRYQGLVQAFCALGRSLGPLFGGVIIDNWS
YKVLFLLAFVVLLIVLAVNIGVVHFNLRKAVNYMKTDVQTDVSRETK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaaagcaactcattaaaacgccgtggctaattgccgggcagtttatgaataac
attggtatgagtttcatttggccgttaacgacgatctacatgcacaatgtgttaggtaag
tcgttgacggagactggaattgtcctgatgctcaattcagttgccaacgttttggcaagt
acgattggtgggcgtatatttgatcgaggtaatccttatcacctgttactgatgggaatc
acgttgaatggcctcgcgaactttgctctgatcttttttcatggatggccgtggtatccg
atgttgttagtcgtgaccgggtttgctagtggctggctaaatacgatgtttaatgctttg
gctgccagtgtcccccgcgataaagtgcggcgaacgtttacgttgatgtatctcgctgcc
aatctcggagttgtcttcggcacgatgctggttggtatcgtgtatagcatggggatggcc
ttgctattctcgatgaccacgagcctcttcgtgattttcttgattattgcattatttgaa
tacaatgtggattcgtcgaacgtgaccggggttgatccgcgccaaggacaagatgtgcac
ttgccacgggccaattttcacattgtctggaccttctttattagtttattcattatctgg
ttgctatacgaacagtgggtcagcaatttatccgtctacatgacgaatttggggatgccg
ctgcggaattacagttttctatggacaatcaacgcgggcttactagtccttattcagagt
attttaagtttgctggggaatcggattaaaaatttatataatcaatttttcttcggcatg
ctattcgtgggcttatcatttctatcacttgtgattgcgcatgattacccacactttatc
tttgccatgattttattgacgattggtgaagcaacttggtcaccagccatgccaacacta
gtgagtcagttatcaccagttagtgctaaggggcgttaccaaggactagtacaagccttt
tgtgcgttagggcgctcgctagggccgttatttggtggtgtgattatcgataattggtct
tataaggtgctgtttttgttggcatttgtggttttattgatcgtgttggcagttaatatc
ggtgtcgttcactttaatttacgcaaggccgttaattatatgaagacggacgttcagacc
gatgtttcacgtgaaacaaaataa

DBGET integrated database retrieval system