KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0017Help
Entry
LBP_cg0017        CDS       T02670                                 

Definition
(GenBank) Lipoprotein, peptide binding protein OppA-like protein
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
19131..20747
Genome map
AA seq 538 aa AA seqDB search
MKKRIWISSIGIVALGLVLTGCGSQQSSQQKTLNVTATQSIATADPNKADDIASQAAIAQ
FMEGLYTTNQKGKVVPAIAKKVVKPTNNGKTYTFNLRHNAKWSNGKKVTAADFVYSVQRQ
VDPNTKSQEVGHVAEIKNATAITAGKKAVKTLGVKALGKYKLQITLQQRVPYFNYRLATE
IYPLNKQFTEKYGNKYGTSAQRTLSNGPYVLKSWNGTNDTWKYVKNPYYYDRKQVRIKNI
KVQTVKNNSTAENLFQSNEVQVTQITGTQVSAAEQGSLKSQMKVTKLNQLYFMLWNQKRS
ALQNTDLRRAVSYALNRQSLVKNVLKDGSVAATSLVPAGNTKNPTTGKDFNTDTGNLYPY
SPAKAKQYWQKAQASLGKQKLTLQLLTNDNDINKSVAEYIQAAIEKNLSGVTVNVKSVPL
TNEISTLSKGDFDFATLSWSSDFQDPVDFLNKASITNSVNFGKFNNAKYEQLISTITADK
QSTKARYQTMQQAAKLVAQQQGVTPIYQTAAAHLISNKVGGVHFTLLRDALYRYAYWK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaatatggatcagcagtattggtattgtagccctaggattagtcttaact
ggctgcggtagccagcagagtagtcagcagaagacgttgaacgtaacggcgacccagtcg
attgcgaccgctgatcctaataaggccgacgatatcgctagtcaggccgctattgctcag
tttatggaaggcttgtatacaactaatcaaaaggggaaagtcgtgccggcaattgccaag
aaagtcgtcaaaccgactaataatgggaagacttatacctttaatttgcggcacaatgcc
aagtggtcgaatggaaaaaaggtcacggccgctgactttgtttattccgtgcaacgccag
gtcgatccgaataccaagtcacaggaagtcggacacgttgctgaaatcaagaatgcaaca
gcaatcacggctggtaagaaggcggtgaagaccttaggcgttaaagcgttgggtaagtat
aagttacaaattacattgcaacagcgcgtgccgtattttaattatcggctagccacagag
atctatccgttaaacaaacaatttactgagaaatacgggaataagtatgggacatcggca
cagcgaacgctctctaatggtccctatgtcttgaagagttggaatgggacgaatgacacg
tggaaatatgtgaagaacccgtattattatgaccgtaaacaggtccgaatcaagaatatt
aaggtgcagacggtcaaaaataacagtacggccgagaacctcttccaaagcaatgaggtc
caagtcacccagattacgggcacccaagtatcggcagctgagcaagggtcactaaaaagt
cagatgaaggttacgaagttaaatcaactctacttcatgttgtggaaccagaagcgctca
gcattgcagaatactgacttgcggcgtgctgtgagttacgctttgaatcgccagtcattg
gttaagaacgttctcaaagacggctcagtagcggcgacgtcattagttcctgctggcaat
accaagaacccgacaacagggaaagattttaatacggataccggaaatttgtatccatac
agtccagcaaaggctaaacagtattggcagaaggctcaggcgagcttaggaaagcaaaag
ttaacactgcaattattgacgaacgataatgatattaataagtcggtggcagaatatatt
caagctgcaattgagaaaaatcttagtggtgtcacggtcaatgtcaagtcagtaccactg
acaaatgagatttcaactttaagcaagggtgattttgactttgccacgttgtcgtggtcg
agtgatttccaagatccagttgatttcttgaataaggcttcgataactaattctgtcaac
tttgggaagtttaacaatgcgaaatatgagcaattaatctcgacgattacggccgataag
cagtcaactaaggcccgatatcagacgatgcagcaagcggctaagctagtcgctcagcaa
cagggggtcacaccgatttatcaaactgctgctgctcacttgatcagtaacaaggttggt
ggggttcacttcacattgttgcgagacgccctttatcgctatgcctactggaagtaa

DBGET integrated database retrieval system