KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0017Help
Entry
LBP_cg0017        CDS       T02670                                 

Definition
(GenBank) Lipoprotein, peptide binding protein OppA-like protein
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LBP_cg0017
Enzymes [BR:lpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LBP_cg0017
Exosome [BR:lpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBP_cg0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
19131..20747
Genome map
AA seq 538 aa AA seqDB search
MKKRIWISSIGIVALGLVLTGCGSQQSSQQKTLNVTATQSIATADPNKADDIASQAAIAQ
FMEGLYTTNQKGKVVPAIAKKVVKPTNNGKTYTFNLRHNAKWSNGKKVTAADFVYSVQRQ
VDPNTKSQEVGHVAEIKNATAITAGKKAVKTLGVKALGKYKLQITLQQRVPYFNYRLATE
IYPLNKQFTEKYGNKYGTSAQRTLSNGPYVLKSWNGTNDTWKYVKNPYYYDRKQVRIKNI
KVQTVKNNSTAENLFQSNEVQVTQITGTQVSAAEQGSLKSQMKVTKLNQLYFMLWNQKRS
ALQNTDLRRAVSYALNRQSLVKNVLKDGSVAATSLVPAGNTKNPTTGKDFNTDTGNLYPY
SPAKAKQYWQKAQASLGKQKLTLQLLTNDNDINKSVAEYIQAAIEKNLSGVTVNVKSVPL
TNEISTLSKGDFDFATLSWSSDFQDPVDFLNKASITNSVNFGKFNNAKYEQLISTITADK
QSTKARYQTMQQAAKLVAQQQGVTPIYQTAAAHLISNKVGGVHFTLLRDALYRYAYWK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaatatggatcagcagtattggtattgtagccctaggattagtcttaact
ggctgcggtagccagcagagtagtcagcagaagacgttgaacgtaacggcgacccagtcg
attgcgaccgctgatcctaataaggccgacgatatcgctagtcaggccgctattgctcag
tttatggaaggcttgtatacaactaatcaaaaggggaaagtcgtgccggcaattgccaag
aaagtcgtcaaaccgactaataatgggaagacttatacctttaatttgcggcacaatgcc
aagtggtcgaatggaaaaaaggtcacggccgctgactttgtttattccgtgcaacgccag
gtcgatccgaataccaagtcacaggaagtcggacacgttgctgaaatcaagaatgcaaca
gcaatcacggctggtaagaaggcggtgaagaccttaggcgttaaagcgttgggtaagtat
aagttacaaattacattgcaacagcgcgtgccgtattttaattatcggctagccacagag
atctatccgttaaacaaacaatttactgagaaatacgggaataagtatgggacatcggca
cagcgaacgctctctaatggtccctatgtcttgaagagttggaatgggacgaatgacacg
tggaaatatgtgaagaacccgtattattatgaccgtaaacaggtccgaatcaagaatatt
aaggtgcagacggtcaaaaataacagtacggccgagaacctcttccaaagcaatgaggtc
caagtcacccagattacgggcacccaagtatcggcagctgagcaagggtcactaaaaagt
cagatgaaggttacgaagttaaatcaactctacttcatgttgtggaaccagaagcgctca
gcattgcagaatactgacttgcggcgtgctgtgagttacgctttgaatcgccagtcattg
gttaagaacgttctcaaagacggctcagtagcggcgacgtcattagttcctgctggcaat
accaagaacccgacaacagggaaagattttaatacggataccggaaatttgtatccatac
agtccagcaaaggctaaacagtattggcagaaggctcaggcgagcttaggaaagcaaaag
ttaacactgcaattattgacgaacgataatgatattaataagtcggtggcagaatatatt
caagctgcaattgagaaaaatcttagtggtgtcacggtcaatgtcaagtcagtaccactg
acaaatgagatttcaactttaagcaagggtgattttgactttgccacgttgtcgtggtcg
agtgatttccaagatccagttgatttcttgaataaggcttcgataactaattctgtcaac
tttgggaagtttaacaatgcgaaatatgagcaattaatctcgacgattacggccgataag
cagtcaactaaggcccgatatcagacgatgcagcaagcggctaagctagtcgctcagcaa
cagggggtcacaccgatttatcaaactgctgctgctcacttgatcagtaacaaggttggt
ggggttcacttcacattgttgcgagacgccctttatcgctatgcctactggaagtaa

DBGET integrated database retrieval system