KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0587Help
Entry
LBP_cg0587        CDS       T02670                                 

Definition
Carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
630448..631197
Genome map
AA seq 249 aa AA seqDB search
MMLKQPEPFFFEHGQHAVILLHAYAGSANDVRMLARALEREDYTVYGPQFSGHATDDPRD
ILAQTPAQWWQDTQQAISFMRQKGYTKISIFGLSLGGIFATAALERDPQLLGGGTFSSPL
FAGNRSDVAEMFITLSHHQLAHSQFSIAEREQILMVLPELVQRQLQAVNTFTTTEVTSHL
SAVTQPFFIGQGGQDELIDATVARQLRDQLPQVPVDFHWYADAGHVITVNSAHHQLEQDV
LTYLKTIYK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgaaacaaccggaaccgtttttctttgaacatggccaacatgccgtcatttta
ttgcacgcctatgcgggaagtgccaatgatgtgcggatgttagcacgagcattagaacgg
gaagattatacagtttatggcccccaattcagtggacacgcgactgatgatccgcgagat
attctcgcacagacgccggcgcaatggtggcaagatacgcaacaagcaatatcatttatg
cggcaaaaaggctatactaaaattagtatctttggcttatcattaggtggtatttttgcg
acggcggccttggagcgtgatcctcagttgttaggtggtggcacgtttagttcaccacta
tttgctggtaatcgtagtgacgttgctgaaatgtttatcacgctgagtcaccatcaactg
gcgcacagtcaattctcaattgccgagcgtgaacagatcttaatggtgttgccagaactg
gttcagcggcaactgcaggcagtcaatacctttaccacgacggaggttacgagtcacctc
agcgctgtgacccaacccttcttcattggtcagggtgggcaagatgaattaattgatgcg
acggtggcgcgacaattacgtgatcaattaccacaagtaccagttgattttcattggtat
gctgatgctggacacgtgattaccgtcaacagtgcgcatcaccaattggaacaagatgtt
ttaacatatttaaaaactatttataaatga

DBGET integrated database retrieval system