KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0587Help
Entry
LBP_cg0587        CDS       T02670                                 

Definition
(GenBank) ATP-dependent Clp protease proteolytic subunit
  KO
K01358  
ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Brite
Enzymes [BR:lpr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.92  endopeptidase Clp
     LBP_cg0587
Peptidases [BR:lpr01002]
 Serine Peptidases
  Family S14: ClpP endopeptidase family
   LBP_cg0587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(618943..619533)
Genome map
AA seq 196 aa AA seqDB search
MYPVPTVIEQSSRGERAYDIYSRLLKDRIIMLSGPIEDNMANAIIAQLLFLDAQDSGKDI
YLYINSPGGVVTAGLAIYDTMNFIKSDVQTIVMGMAASMASVLASSGTKGKRFALPNSEI
LIHQPSGGAQGQQTEIEIVAEEILKTRKKINQILADNSGQSVEKLNHDTERDNYLSAQEA
KDYGLIDDIMENNKLK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtatccagttcctacagttattgaacagtcatcacgtggcgaacgtgcttatgacatc
tattcacgactattaaaggaccgtatcattatgttatccggtcccattgaagataacatg
gcaaacgccattattgcccaactactcttcttggatgcccaagattcaggtaaggacatc
tatctctatatcaactcaccaggtggtgtcgttactgccggcttagcaatctacgatacg
atgaacttcatcaaatctgatgttcaaaccatcgttatggggatggctgcttccatggcc
agcgtcttagcttcatctggtactaagggcaagcgttttgctttacctaactctgaaatc
ttgattcaccaaccatctggtggtgctcaaggtcaacaaacggaaattgaaattgttgcg
gaagaaatcttgaagactcgtaaaaagatcaaccagattttagctgacaactcgggacaa
tccgttgaaaagttgaaccatgatactgaacgtgataactacttaagcgcacaagaggct
aaagactacggtttgatcgatgatattatggaaaacaacaaattaaaataa

DBGET integrated database retrieval system