KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0911Help
Entry
LBP_cg0911        CDS       T02670                                 

Gene name
gdh
Definition
Glutamate dehydrogenase (NADP(+))
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    LBP_cg0911 (gdh)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LBP_cg0911 (gdh)
   00330 Arginine and proline metabolism
    LBP_cg0911 (gdh)
Enzymes [BR:lpr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     LBP_cg0911 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(969082..970437)
Genome map
AA seq 451 aa AA seqDB search
MIILSQATDYVQHVYQVIEHRDPNQTEFLEAINDVFKTITPVLEQHPEYIEANILERLTE
PERIIQFRVPWLDDAGHARVNRGFRVQFNSAIGPYKGGLRLHPSVNLSIVKFLGFEQIFK
NALTGLPIGGGKGGSDFDPKGKSDNEIMRFCQSFMTELSKYIGLDTDVPAGDIGVGGREI
GFLYGQYKRLRGADRGVLTGKGLNYGGSLARTEATGYGLSYYTNEMLKANQLSFPGQRVA
ISGAGNVAIYAIQKVEALGGKVITCSDSNGYVIDENGIDFKIVKQIKEVERGRIKDYADR
VASASYYEGSVWDAQVAYDIALPCATQNEISGDQAKNLIANGAKVVAEGANMPSSPEAIA
AYQASSLLYGPAKAANAGGVAVSALEMSQNSMRLSWTFEEVDNRLKQIMQDIFAHSVAAA
DEYHVSGDYLSGANIAGFTKVADAMLAQGLV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatcatattgagtcaagcaactgattatgtccaacacgtttaccaagtcattgaacac
cgtgatccgaaccaaaccgaatttttagaggccatcaacgacgtcttcaaaacgatcacg
ccagtcctcgaacaacatccagaatatatcgaagccaatattttggaacgtttgaccgaa
ccagaacggattattcaattccgggttccttggctcgacgatgctggtcatgcacgagtc
aaccgtgggttccgagtacaatttaactcagcaatcggtccatacaagggcggcttacgg
ttacacccatccgttaatctgagtatcgtcaaattcttgggctttgaacagatcttcaaa
aatgccctgaccggcctgccaatcggcggtggtaaagggggctctgatttcgaccctaag
ggcaaatcagacaacgaaattatgcgcttctgtcagagtttcatgaccgaactgagcaag
tacattggtctcgataccgacgttcctgctggtgatatcggtgttggtggccgcgaaatt
ggctttttatacggccaatacaagcgactccggggcgctgaccgcggcgtactcaccggt
aaaggtttgaactatggcggttcgttagcccggactgaagctaccggttatggtctctcc
tactataccaacgaaatgctcaaggccaaccaactttccttccctggtcaacgcgttgcc
atttctggtgctggtaatgtcgccatctacgcgattcaaaaggttgaagcactcggtggc
aaggtgattacctgctccgactcaaacggttacgttattgacgaaaacggtatcgacttc
aagatcgtgaagcagatcaaggaagttgaacgtggtcgcatcaaagactatgccgaccgt
gtagccagtgccagctattacgaaggttccgtctgggacgcccaagtagcttatgatatc
gcgttaccttgcgccacccaaaacgaaatcagcggtgatcaagccaagaacttgattgcc
aatggtgccaaggtcgttgccgaaggggctaacatgcctagcagtccagaagccattgcg
gcataccaagcttccagcttgctatatggtccggccaaagctgccaatgctggtggcgtt
gccgtttccgcccttgaaatgagccaaaatagtatgcgtttgagctggacttttgaagaa
gtcgataatcgcctcaagcaaatcatgcaagatatctttgcacactccgttgccgctgcc
gacgaataccacgttagcggtgattacctgagtggtgctaacattgctggcttcacaaaa
gttgctgacgccatgttagcgcaaggcttagtttaa

DBGET integrated database retrieval system