KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0911Help
Entry
LBP_cg0911        CDS       T02670                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBP_cg0911
Enzymes [BR:lpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LBP_cg0911
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LBP_cg0911
Mitochondrial biogenesis [BR:lpr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LBP_cg0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
948479..949903
Genome map
AA seq 474 aa AA seqDB search
MNFVTTIGLEVHVELKTNSKIFSPSPVQFGSEPNANTNVIDWGYPGVLPTPNKGVVEAGI
KAATALHAEIEHHTYFDRKNYFYPDNPKAYQITQHEKPIAHDGWIEIEVDGKKKKIGIEE
MHIEEDAGKNTHENDYSYVDLNRQGTPLIEIVSKPDIASPEEAYAYCEALRQRIQFTGVS
DVKMEEGSMRVDVNISIRPAGSDKYGVKTEMKNLNSFNYVRKSLEYEEQRQQQVLMAGGK
IQQETRRFDETTGQTILMRVKEGSDDYRYFPEPDIPAVDIDDDWIASVKKTIPEMPGSRR
ERYINEFGLTAYDAGVLTQTKEMSDFFDATVAEGADPKLASNYLQGDVNAYLNEHKVDLL
ATDLTPTNLAGMIKMISDETISSKIAKKVFKAIMAGSEPVQWVNDKGLVQLSDPAKLQPI
VDDVLDNNQQSIDDFKNGKDRAVGFLVGQIMKKTRGQANPKVVNQLLMTSLKAR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgtaaccacgattggtttggaagtccacgttgaattaaaaacgaactcaaaa
atctttagtccttcacccgtgcaatttggttccgaaccaaatgccaacacgaacgtgatc
gactgggggtatccgggggtattgccaacgcctaacaagggcgtggtcgaagctgggatt
aaagcagcaacggctttacatgctgaaatcgaacatcacacgtactttgaccggaagaac
tatttttacccggataacccgaaggcctaccaaattacgcaacatgaaaaaccaattgcg
catgatggttggattgaaatcgaagttgatggtaaaaagaaaaaaatcggtatcgaagag
atgcatattgaagaagatgccgggaaaaacacccatgaaaacgactattcctatgtcgat
ttgaaccggcaagggacgccgctaattgaaattgtttctaagcctgacattgcctcccca
gaagaagcttatgcttactgtgaagcgttgcggcaacggatccaatttacgggcgtttcg
gacgttaagatggaagaaggttcaatgcgggtcgatgttaacatttcaattcggccggcc
ggttccgacaagtatggtgtgaagaccgaaatgaagaacttgaactccttcaactacgtg
cgcaagtcgttagaatatgaagagcaacgccaacaacaagttctcatggcgggtggcaag
atccaacaagaaacgcggcgttttgatgaaacaacgggccaaacgatcttgatgcgggtc
aaggaaggtagcgatgattaccgttacttcccagaacctgatattccagcagtcgatatc
gatgatgactggattgcatccgttaagaagaccattccagaaatgcctggttcgcggcgt
gaacgttacatcaatgaatttggtttaactgcttatgatgcgggtgtgttgacccaaact
aaggaaatgtctgacttctttgatgcaaccgttgctgaaggtgcggatcctaaattagct
tcaaactacttgcaaggggacgttaacgcgtacttgaacgagcataaagttgatttgtta
gcgactgacttaacgccaactaacttagctgggatgatcaagatgatttcagatgaaacc
atctcaagtaagattgctaagaaggtctttaaggccattatggcgggctcagaacctgtc
caatgggtcaacgacaagggcttagtccaattgtctgatccggcgaagttacaaccaatc
gttgacgacgtattggataataatcaacaatcaattgatgactttaagaacgggaaagac
cgggccgttgggttcctcgtgggtcaaatcatgaagaagacacgtggtcaagctaacccg
aaagtcgtcaaccaactattaatgacatcattaaaagcacggtag

DBGET integrated database retrieval system