KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1111Help
Entry
LBP_cg1111        CDS       T02670                                 

Gene name
fpg
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    LBP_cg1111 (fpg)
Enzymes [BR:lpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     LBP_cg1111 (fpg)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     LBP_cg1111 (fpg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1202588..1203442
Genome map
AA seq 284 aa AA seqDB search
MVRCKIGGTTMPELPEVETVRRGLNRLVSGATIASIEVFWPKIINNDVDSFKQRLANQTI
QTIDRRGKYLLFRFSNGLTMVSHLRMEGKYNVVPRGEDQGKHTHVIFHLTDDRDLLYNDT
RKFGRMTLVPTGEENTVAGLRTIGPEPVAEQLTLAYMTATFGKSKKMIKPLLLDQSKIAG
IGNIYADETLWMSKIHPMRPANSLTTDEIATLRQNIIDEMAMAIKGHGTTVHSFSTAFGE
AGQFQNHLHVYGREGEPCERCGTIIEKIKVAQRGTHFCPLEQRL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttggtacgatgcaaaatagggggaaccaccatgcctgaattacctgaagttgaaactgtt
cgtcgcggcttaaatcgtctggttagcggggcaacgattgctagtatcgaggttttttgg
ccgaaaattattaataatgatgtcgatagtttcaaacagcgtttagccaaccaaacgatc
cagaccattgatcggcgggggaagtatttattgtttcgctttagcaatggtctgacgatg
gtgtcgcatttgcggatggaaggcaagtataatgttgtaccgcgtggtgaagatcaaggt
aaacacacgcacgtgatcttccatctgaccgatgatcgtgatttgttgtacaacgatacg
cgtaagttcgggcgaatgacgctcgtgccgaccggtgaagaaaacacggtggcgggattg
cggacaattggcccggaacccgttgctgaacagttaacactggcttatatgacggccact
tttggcaagtcgaaaaagatgatcaaaccactattgttggatcaaagtaagattgcgggc
attgggaacatttatgcggacgaaacgctatggatgagtaagattcatccaatgcggcct
gctaattcactaactactgatgagattgcaacattgcgccaaaacattattgatgaaatg
gcgatggcaattaaaggtcacggcaccactgttcattcattttcaacggcatttggtgag
gccggtcagtttcaaaatcacttacacgtctatggtcgtgaaggggaaccttgcgaacgg
tgtggcacgattattgagaaaatcaaagtggcacagcgagggacccatttttgtccgtta
gaacaacggttgtag

DBGET integrated database retrieval system