KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1111Help
Entry
LBP_cg1111        CDS       T02670                                 

Definition
(GenBank) Cell surface protein
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
complement(1173475..1173846)
Genome map
AA seq 123 aa AA seqDB search
MAKFRRLVLLSLSLGLALAGGCRSPDALAATPTDTSVTLTDWQAGTDLTNFQHPRPYQYL
AVPNIIATANQQASTQTPSSAAIRPDQSVLPQTNEARQLLVWLGLLTAVLAGWLVWLMQR
RRE
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattcaggcggctagttttactatcattaagccttggactagccctcgctggt
ggctgtcggagtcccgatgccctagcggctaccccaactgacactagtgtgacattgacc
gactggcaagccgggacggacctgacaaacttccagcacccccgtccctatcaatatcta
gcggtgcccaacatcatcgccactgctaatcaacaggcttcgactcagacaccatcatcc
gcggcaatacgtccagatcaatcagtgctaccacaaacgaatgaagcccgccaactgtta
gtctggttaggtctgttgacagctgtcttagccggttggctcgtgtggctcatgcaacgc
cgaagggagtga

DBGET integrated database retrieval system