KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1815Help
Entry
LBP_cg1815        CDS       T02670                                 

Gene name
rbsK2
Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBP_cg1815 (rbsK2)
Enzymes [BR:lpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LBP_cg1815 (rbsK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1896699..1897619)
Genome map
AA seq 306 aa AA seqDB search
MNKVTVLGSLNVDSILRFKRFPKPGETLPLTGKSVAGGGKGANQAIAAARAGAQTTFIGK
VGTDQEGAFMVQQLTNSGVNDQYVQHSNVASTGSAFILLDSSSENRILIDGGTNQQVTAE
DVERAQPAISASTFLIAQFETPIAATIRGFELAQAAGQKTILNPAPATTTVPAELLATTD
LIVPNETETETLTGVHITDEQSMIQGAQKLQALGVANVIITVGSKGAFWMRGAEHGFVPA
YKVEAVDTTAAGDTFIGALSSVLMPDFSNLAAAVRFANRASSIAVQKLGAQPSIPTKEAI
EAAERA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtaaccgtactaggtagtttgaatgttgattcgattttgcgtttcaagcgt
tttcctaagcctggtgaaacgctaccgctgactggtaagagtgtcgctggtgggggtaaa
ggggctaaccaagccatcgcagccgcgcgcgctggtgcccaaacgacttttatcggtaaa
gttggtactgatcaggaaggggcctttatggtgcagcagttgacgaatagtggtgttaat
gaccaatatgttcaacatagcaatgtggctagtaccggctcagctttcatcttgttagat
agtagtagtgagaaccgtatcttaatcgatggtggaactaatcagcaggttacggccgaa
gatgtcgaacgggcccaacccgcaattagcgctagtacttttttgattgcacagtttgaa
acgccgattgcagcaacgattcgagggtttgaattggctcaggccgctgggcaaaaaacg
attttaaacccggcaccagctacgacgacggtgcccgcagaattactagcgacgaccgac
ttaattgttcctaacgaaactgagacggaaaccttgactggcgtgcacattactgatgag
caatcgatgattcagggtgcacagaagttgcaggcgctgggcgttgctaacgtgatcatt
accgttgggagtaaaggcgctttctggatgcgcggtgctgagcacggcttcgtcccagct
tataaggttgaggccgttgacacgactgcagctggggacacctttattggtgcactcagt
tcggtcttaatgccagactttagtaatttggccgctgcggtacggtttgccaaccgggca
tcttcgatagctgttcaaaaattgggtgcgcaaccatcgattccaactaaggaagccatt
gaagcggctgagcgggcctaa

DBGET integrated database retrieval system