KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1815Help
Entry
LBP_cg1815        CDS       T02670                                 

Definition
(GenBank) GTP pyrophosphokinase (Putative)
  KO
K07816  
putative GTP pyrophosphokinase [EC:2.7.6.5]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LBP_cg1815
Enzymes [BR:lpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     LBP_cg1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1865943..1866605)
Genome map
AA seq 220 aa AA seqDB search
MEDWNHFLLPYQQAVDELKVKLRGMRKQFRDLNQHEPIEFVTGRVKPVDSIKEKMTRRKV
QEDRLEQDMQDIAGLRIMCQFVEDIYQVVDLLRKRTDMTILEERDYISNEKPSGYRSYHI
VIEYPVQMVGGEKKILAEIQVRTLAMNFWATIEHSLNYKYQGDFPENLSQRLQRAAEAAF
SLDKEMSEIREEIQEAQSLFSYGKGPGNDEPDTTKEDQNS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaagattggaatcattttttactgccttatcagcaagccgttgatgagcttaaagtt
aaattgcggggaatgcgcaaacaatttcgtgatttgaatcagcatgaaccgattgaattt
gtaacggggcgggtcaaacccgttgatagcattaaggaaaagatgacccgacgtaaagta
caagaagatcgcctagaacaagatatgcaggatattgctggtttgcggattatgtgtcaa
ttcgttgaggatatctatcaggtcgttgatttattgcgaaaacggacggatatgacaatt
ctggaagaacgcgattacattagtaatgaaaagccatctggttaccgttcgtatcatatc
gtgattgaatatccggtccaaatggtcggtggtgaaaagaaaattttggccgaaatccaa
gtccggacacttgccatgaatttctgggcgaccattgaacattcgcttaactataaatat
caaggggatttccctgaaaacttgagtcaacgattacaacgggctgcggaagccgccttt
agtttggataaagaaatgtcagaaattcgtgaggaaattcaagaagctcagagcttgttc
tcgtatgggaaggggccgggcaacgatgagcctgacacgacaaaggaagatcaaaattca
tga

DBGET integrated database retrieval system