KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1927Help
Entry
LBP_cg1927        CDS       T02670                                 

Definition
(GenBank) L-2-hydroxyisocaproate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
lpr00010  Glycolysis / Gluconeogenesis
lpr00270  Cysteine and methionine metabolism
lpr00620  Pyruvate metabolism
lpr00640  Propanoate metabolism
lpr01100  Metabolic pathways
lpr01110  Biosynthesis of secondary metabolites
lpr01120  Microbial metabolism in diverse environments
lpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBP_cg1927
   00620 Pyruvate metabolism
    LBP_cg1927
   00640 Propanoate metabolism
    LBP_cg1927
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LBP_cg1927
Enzymes [BR:lpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     LBP_cg1927
Exosome [BR:lpr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LBP_cg1927
  Exosomal proteins of breast milk
   LBP_cg1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C F420_oxidored Sacchrp_dh_NADP TrkA_N ApbA DAO 3HCDH_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGL64673
Position
complement(1987834..1988751)
Genome map
AA seq 305 aa AA seqDB search
MRKYGVIGLGQVGATVAYTLVQQGTVDELVLIDKNEALAKAQKLDLDDASPRLSSTTKII
LNDYSALADAEVLIVASGNIGAIDMNSSKGRFGEYDLNQAIVREIAPKIVASGFKGILID
IMNPCDVMTDYLQRMTGFPRQRVFGTGTFLDTARMQKYVGQAAGTNGKNVAGYVYGEHGN
SQFVAWSTVSVNGQPIKNFPGLNLDQLEEDARQGAFAVMAGKHYTNFAIATCGVRLAEAV
SADAQLACPVSAFDPQYGTYVGMPAVIGKNGIESLIQLDLTTDERASLAASAKFIKSQVD
VLPQA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaatatggtgtgatcgggttaggccaagtcggtgcgacagtggcttatacgttg
gttcaacaaggaaccgttgatgaattagttttaatcgataagaatgaggccttggccaag
gcgcaaaaactcgatttagacgacgcgtcacctcgtctaagctcaaccactaagattatt
ttaaacgattattcagctttggccgatgccgaagtgttgatcgtggcttctggcaatatt
ggtgccattgatatgaatagttccaagggtcgctttggtgagtatgatttaaaccaagcg
attgtacgggagatcgcgcccaagattgtggcatctggcttcaagggtattttgatcgat
attatgaatccgtgtgacgtcatgacggattatttacaacgaatgacaggttttccacgg
caacgggtttttggtacggggaccttcttagatacggcgcggatgcaaaagtatgtcgga
caagcagctggtacgaatggtaaaaatgttgcggggtacgtatatggcgaacacggcaac
tcacaatttgtagcttggtcaacggttagcgtcaatgggcagcctatcaaaaatttccca
ggtctgaaccttgatcaacttgaagaagatgcaaggcaaggggcatttgcagtcatggcg
ggtaagcattatacaaactttgcgattgctacttgtggtgtccgattggcagaagctgtc
agtgcggatgcacaactggcttgcccagtttcagcttttgatccgcaatatgggacatac
gttggcatgcctgctgtgattggtaaaaacgggattgaatcattaattcaactagatctg
accactgatgaacgagcgtcgttagcagcgtcagcgaagtttatcaagtcgcaagtggac
gttttaccgcaagcataa

DBGET integrated database retrieval system