KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1927Help
Entry
LBP_cg1927        CDS       T02670                                 

Definition
(GenBank) L-2-hydroxyisocaproate dehydrogenase
  KO
K00016  
L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBP_cg1927
   00620 Pyruvate metabolism
    LBP_cg1927
   00640 Propanoate metabolism
    LBP_cg1927
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LBP_cg1927
Enzymes [BR:lpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     LBP_cg1927
Exosome [BR:lpr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LBP_cg1927
  Exosomal proteins of breast milk
   LBP_cg1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1987834..1988751)
Genome map
AA seq 305 aa AA seqDB search
MRKYGVIGLGQVGATVAYTLVQQGTVDELVLIDKNEALAKAQKLDLDDASPRLSSTTKII
LNDYSALADAEVLIVASGNIGAIDMNSSKGRFGEYDLNQAIVREIAPKIVASGFKGILID
IMNPCDVMTDYLQRMTGFPRQRVFGTGTFLDTARMQKYVGQAAGTNGKNVAGYVYGEHGN
SQFVAWSTVSVNGQPIKNFPGLNLDQLEEDARQGAFAVMAGKHYTNFAIATCGVRLAEAV
SADAQLACPVSAFDPQYGTYVGMPAVIGKNGIESLIQLDLTTDERASLAASAKFIKSQVD
VLPQA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaatatggtgtgatcgggttaggccaagtcggtgcgacagtggcttatacgttg
gttcaacaaggaaccgttgatgaattagttttaatcgataagaatgaggccttggccaag
gcgcaaaaactcgatttagacgacgcgtcacctcgtctaagctcaaccactaagattatt
ttaaacgattattcagctttggccgatgccgaagtgttgatcgtggcttctggcaatatt
ggtgccattgatatgaatagttccaagggtcgctttggtgagtatgatttaaaccaagcg
attgtacgggagatcgcgcccaagattgtggcatctggcttcaagggtattttgatcgat
attatgaatccgtgtgacgtcatgacggattatttacaacgaatgacaggttttccacgg
caacgggtttttggtacggggaccttcttagatacggcgcggatgcaaaagtatgtcgga
caagcagctggtacgaatggtaaaaatgttgcggggtacgtatatggcgaacacggcaac
tcacaatttgtagcttggtcaacggttagcgtcaatgggcagcctatcaaaaatttccca
ggtctgaaccttgatcaacttgaagaagatgcaaggcaaggggcatttgcagtcatggcg
ggtaagcattatacaaactttgcgattgctacttgtggtgtccgattggcagaagctgtc
agtgcggatgcacaactggcttgcccagtttcagcttttgatccgcaatatgggacatac
gttggcatgcctgctgtgattggtaaaaacgggattgaatcattaattcaactagatctg
accactgatgaacgagcgtcgttagcagcgtcagcgaagtttatcaagtcgcaagtggac
gttttaccgcaagcataa

DBGET integrated database retrieval system