KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1927Help
Entry
LBP_cg1927        CDS       T02670                                 

Gene name
tdk
Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LBP_cg1927 (tdk)
Enzymes [BR:lpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LBP_cg1927 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2012672..2013259)
Genome map
AA seq 195 aa AA seqDB search
MSRLAQLFFRYGAMNSGKTIEILKVAHNYEEQDKSVIILTSGLDNRDGVGYVASRIGLKR
EATPVFDDTNIFEIVKQTNPDAACVLIDEAQFLKKHHVLELADIVDELKIPVMTFGLKND
FRNELFEGSKYLLLYADKIEEMKTICWFCRKKAIMNLRFHDGQPVYEGEQVQIGGNEAYY
PVCRHHYFYPPKLTK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcttggcacagttattttttcgatatggcgcgatgaacagtggtaaaaccatt
gaaattttgaaagttgcccataactatgaggaacaagataagtcggtcattatcttaacg
agtggcttagataatcgtgatggtgtgggctatgttgcgagtcgcattggccttaaacgt
gaagcaacgccagtatttgatgataccaatatttttgagatcgttaaacaaacgaatccg
gatgctgcgtgcgttttaatcgacgaagcccaatttttgaaaaagcatcacgtcctagaa
ttggctgacattgttgatgagctaaagattccagtaatgacgtttggtttaaagaatgat
tttcgtaacgaattgtttgaaggtagcaagtacctactgctatatgcggacaagatcgaa
gaaatgaagacgatctgctggttctgtcgtaaaaaagcaattatgaatttacggttccac
gatggtcagcccgtttatgaaggcgaacaagttcaaatcgggggtaatgaggcgtactac
ccagtttgtcgtcatcattatttttacccgccgaaattaacaaagtga

DBGET integrated database retrieval system