KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2825Help
Entry
LBP_cg2825        CDS       T02670                                 

Definition
(GenBank) Transcription regulator
  KO
K01621  
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBP_cg2825
Enzymes [BR:lpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LBP_cg2825
    4.1.2.22  fructose-6-phosphate phosphoketolase
     LBP_cg2825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2891518..2891964)
Genome map
AA seq 148 aa AA seqDB search
MKTTATILKEIRQHYQISQAKLAKLLNTSVRTVQHWEQADYQPSGTAVRLIQILATDDAV
YTALTNLEEENTIMYLEHDDQKFTIMGVQFRNQEEYRATMNAIISNMYEGFEPTKEDIQD
ARRFYDEGPISAQEMLAKICTSTNRKAE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaccgccacaatccttaaggagattcggcaacattaccaaattagtcaggca
aagctggcaaagttactcaacacctcggttagaacggtgcagcactgggaacaagcggac
taccaaccaagtggcaccgcggtacgtttgattcagattttggctacggacgatgcggtg
tataccgcactgacaaacctcgaggaggagaatacgattatgtatttagaacacgatgat
cagaagttcaccatcatgggtgtgcagtttcggaatcaagaggaataccgggcgaccatg
aatgcaattatcagtaacatgtatgaaggttttgaaccgactaaggaagatatccaagat
gctcgtcgtttctatgacgaaggcccgattagtgcccaagagatgctagcaaagatatgt
acttcgaccaataggaaagctgaatga

DBGET integrated database retrieval system