KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2825Help
Entry
LBP_cg2825        CDS       T02670                                 

Definition
(GenBank) Transcription regulator
  KO
K07726  
putative transcriptional regulator
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Brite
Transcription factors [BR:lpr03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    LBP_cg2825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2891518..2891964)
Genome map
AA seq 148 aa AA seqDB search
MKTTATILKEIRQHYQISQAKLAKLLNTSVRTVQHWEQADYQPSGTAVRLIQILATDDAV
YTALTNLEEENTIMYLEHDDQKFTIMGVQFRNQEEYRATMNAIISNMYEGFEPTKEDIQD
ARRFYDEGPISAQEMLAKICTSTNRKAE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaccgccacaatccttaaggagattcggcaacattaccaaattagtcaggca
aagctggcaaagttactcaacacctcggttagaacggtgcagcactgggaacaagcggac
taccaaccaagtggcaccgcggtacgtttgattcagattttggctacggacgatgcggtg
tataccgcactgacaaacctcgaggaggagaatacgattatgtatttagaacacgatgat
cagaagttcaccatcatgggtgtgcagtttcggaatcaagaggaataccgggcgaccatg
aatgcaattatcagtaacatgtatgaaggttttgaaccgactaaggaagatatccaagat
gctcgtcgtttctatgacgaaggcccgattagtgcccaagagatgctagcaaagatatgt
acttcgaccaataggaaagctgaatga

DBGET integrated database retrieval system