KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2825Help
Entry
LBP_cg2825        CDS       T02670                                 

Gene name
xpk2
Definition
putative phosphoketolase 2
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBP_cg2825 (xpk2)
Enzymes [BR:lpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LBP_cg2825 (xpk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2957297..2959708
Genome map
AA seq 803 aa AA seqDB search
MQRSCKIMSEAIKSKTVDYSSDDYLKRVDAYWRAANYISVGQLYLLNNPLLREPLKATDV
KVHPIGHWGTIAGQNFIYAHLNRAINKYGLNMFYIEGPGHGGQVMVSNSYLDGTYTETYP
KITQDKAGMKRLFKQFSFPGGVASHADPKTPGSIHEGGELGYSILHGAGAVLDNPGLIAA
TVVGDGESETGPLATSWQVNKFLNPITDGTVLPILNLNGFKISNPTVLSRESHEELEDYF
KGLGWDPHFVEGTDPAKMHKIMAEELDKVIEEIHAIRKNAKDNNDESRPKWPMIVFREPK
GWTGPKSWDGEPIEGSFRAHQIPIPVDRNHMEHADKLVDWLKSYKPEELFDENGTLKPEI
AAIIPEGQARMAANPVTNGGKLTKDLITPNIDDYALDNKDHGKEDGSDMTELGKYIRDLI
ELNKDNKNFRGWGPDETLSNKLGAAFEDTKRQWMEPIHEPNDALLAPQGRIIDSMLSEHM
DEGMLEAYNLTGRYGFFASYESFLRVVDSMLTQHFKWLRNSHEETPWRVDVPSLNVIASS
TAFQQDHNGYSHQDPGIISHLAEKKTEYVRAYLPGDANTLIATFDKAIQSKQLINLIIAS
KHPRPQWFTMDEAKHLVRDGLGVVDWASTDNGEEPDVVFATAGSEPTTESLAAVSILHAR
FPEMKIRFINVVDLLKLKKDDPRGLSDAEFDAFFTKDKPVIFAYHAYDDLVKTIFFDRHN
HNLHVHGYREEGDITTPFDMRVRNELDRFHLVKAALLATPAYAEKGAHVIQEMNSILNKH
HDYIRAEGTDLPEVENWKWTALK
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaggagttgcaaaataatgagtgaagcaattaaatccaaaacagttgattattct
tctgatgactatctaaaacgcgtcgatgcctattggcgcgctgctaactacatctcagtt
ggtcaactctatctattaaataatccgttacttcgggaaccattaaaggcgaccgatgta
aaagtccatccaatcggtcattggggcacaattgccggccaaaactttatttatgcccat
ttgaaccgtgctattaacaagtatgggctcaacatgttctacatcgaaggtcctggtcat
ggtggccaagtaatggtttctaactcctacttagatggtacttatacggaaacgtatcct
aaaatcacccaagacaaggccggaatgaagcgcttattcaagcaattctcattcccaggt
ggtgttgcctcccacgccgaccctaagacaccaggctcaatccacgaaggtggcgaactt
ggctactcaatcttgcatggtgctggtgcggtcttagataaccctggtttaattgctgct
actgttgttggtgatggtgaatctgaaactggcccattggcaacttcttggcaagttaac
aagttcctcaacccaattacagacgggacagtcttaccaatcttgaacttaaacggcttc
aagatttctaacccaacagttctttcacgtgaatcacatgaagaacttgaagactacttt
aaaggtctaggctgggatccacactttgttgaaggtacagaccctgccaagatgcacaaa
atcatggctgaagaattggataaagtcattgaagaaatccacgcaattcgtaagaacgcc
aaggataacaatgatgaatctcgtcctaagtggccaatgattgttttccgggaacctaag
ggctggaccggtcctaagagttgggacggcgaaccaattgaaggttcattccgggctcac
caaattccaattcctgtcgatcgcaatcacatggaacacgccgacaaattagttgactgg
ctcaaatcatacaaaccagaagaattatttgatgaaaatggtactttaaaaccagaaatt
gccgcaatcatccctgaaggccaagctcgtatggctgctaatcccgtcactaacggcggc
aagttaactaaagacttaattacaccaaatatcgatgattatgctttggacaacaaggat
cacggtaaggaagacggttcagacatgactgaacttggtaagtatatccgtgatttaatc
gaattaaacaaagataacaagaacttccgcggttggggtcctgatgaaactttatctaac
aaattaggagctgcgtttgaagataccaagcgtcaatggatggaaccaatccacgaacct
aacgatgctttgttagcacctcaaggccggattattgactccatgttgtcagaacatatg
gatgaaggcatgttggaagcttacaacttaactggtcgttacggcttctttgcaagttat
gaatcattcctacgcgttgtggattcaatgttaacccaacatttcaagtggttacggaat
tctcacgaagaaacaccttggcgggttgatgtcccttcattaaacgtgattgcatcatca
actgccttccagcaagatcacaatggttactctcaccaagatccaggtatcatctcacac
ttggctgaaaagaagaccgaatatgttcgggcctatctcccaggtgacgctaacaccttg
attgcaacttttgataaggcgatccaaagtaaacaattgattaacttgatcatcgccagc
aagcatccccgtccacaatggtttacgatggacgaagctaagcatttagttcgtgatggc
ttaggtgtggttgattgggcaagtactgataatggtgaagaacccgacgttgtcttcgca
actgccggctctgaaccaacgactgaaagtttagcggccgtatcaatcttgcacgctcgc
ttccctgaaatgaagattcgcttcattaacgttgtcgatcttctgaagttgaagaaggac
gacccacggggcttatcagatgctgaatttgatgccttcttcactaaagacaagccagtt
atctttgcataccatgcttacgatgacttagtaaagaccatcttcttcgaccgtcataac
cataacttacacgttcatggctaccgcgaagaaggcgacattaccacgccattcgacatg
cgtgttcgcaacgaactcgatcgtttccacttagttaaagctgccttattagcaacgcca
gcctatgccgaaaaaggtgcccatgtcatccaagagatgaacagcatcttaaacaagcat
catgactatatccgtgctgaaggtactgatcttccagaagttgaaaactggaaatggact
gcattgaagtag

DBGET integrated database retrieval system