KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2861Help
Entry
LBP_cg2861        CDS       T02670                                 

Definition
(GenBank) Sugar transport protein
  KO
K16211  
maltose/moltooligosaccharide transporter
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Brite
Transporters [BR:lpr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   LBP_cg2861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2938821..2940242
Genome map
AA seq 473 aa AA seqDB search
MNQPAVHPNKPIADVSSKPKTSIIANSLPNLPLKTIFAITFGFCGVNMAFSLQSSQMSRI
FQTIGADPTKLGLFFILPPLAGLFVQPLVGKYSDRTWTRFGRRMPYLLFSAPLAALVMVL
LPNAGSFGFGYASTAALLFGAIAILFMDLSSNVCMQPFRMIIGDMVNENQKDKAWSWQQA
FSNLGGVLATILPFVLTYFGVANTAQKGVVPLSVRIAFYIGAIILLGISAYTIHTVKEYD
PDTYALYHHIDPEQHKHTKPIWQLVKEAPKAFWEVALVQLFAWIGIQYMWTYTTGAIAEN
VWHTTNAASAGYQAAGNWYGILTFIQSMAAVLYGFLVLSRTNPYKRKFWYRFGLASFAVG
LVWVFFIHNQYLLIAPFCLIGIGFFTVHVEPFNIFTSSLDGANEGSYIGIFNGTICLPQI
LASVASFMVFKFVGNSMPGMMLIAGISMFIAVLAISIIKQDKPQEDLSENPTK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacctgcagtacacccgaataaaccaatcgctgatgtttccagtaagcctaag
acatctattattgctaattcgctgcccaacctcccattaaaaaccatctttgcaattacc
tttggtttttgtggggttaatatggccttctcattacaatcatcacagatgagccggatt
ttccagaccattggcgctgatcccaccaaactaggactcttcttcattctgccgccattg
gctggattattcgtccaaccactagtcggtaaatactctgatcgaacttggacgcgcttt
ggtcgtagaatgccctacttactattcagcgcaccattagcggcgttggtcatggtgtta
ttaccaaatgctggttcattcggctttggctacgcttcaactgctgcattactatttggt
gctattgctattttatttatggatttatcaagtaatgtttgcatgcaaccattccgcatg
attattggagatatggttaatgaaaatcagaaggacaaagcatggtcttggcaacaagct
ttcagtaacctaggaggcgtacttgctactattctaccgttcgtcctaacttactttggt
gttgcaaacacggcgcaaaaaggcgttgtccctctttctgtaagaattgcgttttatatt
ggtgccattattttattaggcatctcagcatatactattcatacggttaaggaatatgat
cctgacacgtacgcactttatcatcatatcgatcctgaacaacataagcacaccaagcct
atttggcaattagtaaaagaagccccgaaagctttctgggaagttgccctcgttcaacta
tttgcctggattggtattcaatatatgtggacttatactactggtgctatcgccgaaaac
gtttggcacacaactaatgctgcttcggctggctatcaagctgccggtaattggtatgga
atcttgaccttcattcaatcaatggccgccgttctatatggtttcttagttctttcacgg
actaatccatacaagcgaaagttttggtatcgctttggcttagctagcttcgcagttggc
ctcgtttgggtattcttcattcacaaccagtacctattaattgccccattctgtttaatc
ggtatcggcttctttacggtgcatgtcgagccctttaatatctttacttcttcactagat
ggtgccaatgaaggctcatatattggaatttttaacggtacgatttgcttgccacaaatt
ctcgcatccgttgccagctttatggtctttaaattcgttggtaattcgatgcctggaatg
atgcttattgctggtatctcaatgttcatcgcagtacttgccattagtattattaagcaa
gacaagcctcaagaagatttgtcagagaatccaactaaataa

DBGET integrated database retrieval system