KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2868Help
Entry
LBP_cg2868        CDS       T02670                                 

Definition
(GenBank) Transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
lpr00030  Pentose phosphate pathway
lpr01100  Metabolic pathways
lpr01110  Biosynthesis of secondary metabolites
lpr01120  Microbial metabolism in diverse environments
lpr01130  Biosynthesis of antibiotics
lpr01200  Carbon metabolism
lpr01230  Biosynthesis of amino acids
Module
lpr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lpr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBP_cg2868
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    LBP_cg2868
Enzymes [BR:lpr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     LBP_cg2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C DXP_synthase_N Terpene_synth
Motif
Other DBs
NCBI-ProteinID: AGL65614
Position
complement(2946966..2948963)
Genome map
AA seq 665 aa AA seqDB search
MFDKVDELGVNTIRTLSIEAIQKANSGHPGLPMGAAPMAYVLWTKHLKVNPQTHMNWVNR
DRFILSAGHGSAMLYSLLHLAGYDVSIDDLKHFRQWDSRTPGHPEYGHTDGVEVTTGPLG
QGFGMAVGMAMAEAHLAAQYNRPNFPIVDHYTYTIVGDGDLMEGISHEAGSLAGHLKLGK
LIALYDSNGISLDGKTSQAFTENVGDRFTAYGWQHLVVEDGNDLDAIDAAIELAKKTTDR
PSLIEVKTVIGYGAPKQGTNAVHGNPIGADGIKAAEKVYGWNYSDFEVPSAVSDRFEVTI
QENGARAEQQWKRLFEEYEAKYPDQAQSFKQAFNGQFSDDLKSTLPHYQLTDALASRAAS
AKAINAAAKVIPSLWGGAADLSSSNKTMIAETSDFQPESYDGRNIWFGVREFGMAAAMNG
IVLHGGTRVFGGTFFVFTDYLRAAVRLSALQHAPVIYVLTHDSIAVGEDGPTHEPIEQLA
SLRCMPNVQVIRPADGNETSAAWEQALKTTDKPTVLVLSRQALKTLPVSVDTAFAGVEKG
GYVVSAAQKEIPDGLLIATGSEVNLALEAKAQLAKHNQDVAVVSIPSFDRFAQQSPKYRA
SVLPSAVTRRVTIEAGSTFGWDQYAGDHGAKIGVDRFGTSAPGDLVLDKYGFNVTNVVNT
YLKLK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataaagttgacgagctgggtgttaatactattcggacgttaagtatcgaagca
attcaaaaagcaaattccggacatccagggttaccgatgggagccgcaccaatggcctat
gtgttatggacaaaacatctaaaagtcaacccacaaacacatatgaattgggttaatcgt
gatcgtttcattctttcagctggacatggttcagctatgttatacagcctgttacattta
gccgggtatgatgtttcgattgatgatctcaagcattttcggcagtgggacagtcggact
ccggggcatccagagtatggacataccgatggcgttgaagtaactactggtccgttggga
caaggcttcggtatggccgttggaatggcaatggcggaggcacatctagctgcccaatat
aaccgacctaattttccaattgttgatcattacacttatacaattgtcggtgatggcgac
ttaatggaaggaatttcgcacgaagctggttcactagctgggcatcttaagctgggaaag
ttaattgcactttacgattcgaacggcatttcattagatggtaagacgtcgcaagcgttt
actgaaaatgttggtgacaggttcactgcttatggctggcagcatctggtggttgaagat
gggaatgatcttgatgcaattgacgcggcaatcgaacttgcaaaaaagacaactgaccgt
ccttctttgattgaagtgaaaacggtgattggttatggcgcacctaaacaagggactaat
gctgttcatggtaacccaattggtgcggatggcattaaagcagctgaaaaagtatatggc
tggaattactcggattttgaagtgccgtcagctgtttcagaccggtttgaagtaactatt
caggaaaatggtgcgcgtgctgagcagcaatggaaacggctatttgaagaatatgaggcg
aagtatccagatcaggcgcagtcttttaagcaagcgttcaacggacaattttctgatgac
ttgaaatctactttaccgcactatcaattaacagatgcattggctagtcgggcggcaagc
gctaaggcgattaacgctgctgccaaagtaatacctagcttatggggtggcgcagccgat
ttgtcgagttcgaacaaaacaatgattgcggaaacatcagactttcagccagaatcctac
gatggtcgtaatatctggtttggtgtacgtgaatttggcatggcggctgcgatgaacgga
attgtattacatggcggcactcgggtattcgggggaacattctttgtcttcactgattac
ttacgtgcggcagtccggttgtccgcactacaacacgcaccggttatctacgtcttaacg
catgattcaattgcggtcggcgaggatgggccgacccacgaaccgattgaacaattagct
agtttacgatgcatgccgaacgtacaagtgattcggccagctgatggtaatgagacttca
gctgcgtgggagcaagcactgaaaacaactgataaaccaaccgttctggtattgagtcga
caagccttgaagacattacctgtatcagttgatacggcctttgctggcgttgaaaagggt
ggctatgtggtcagtgctgctcaaaaagaaataccagatggtttactaattgcgactggt
tctgaagttaacttagcattggaggccaaagcccagttagcaaagcataatcaagatgtc
gcggtcgtttcaattccgagctttgatcggtttgcgcaacaatcaccaaaatatcgcgct
agtgtgcttccgagtgcggtcacaagaagggtgacaattgaagctggatcaacatttggc
tgggatcagtatgctggcgatcatggtgctaagataggtgtggatcgcttcggcacttcg
gcacctggtgacttggtacttgataagtatggctttaatgtaactaatgttgtgaatact
tatctgaaattaaaataa

DBGET integrated database retrieval system