KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2868Help
Entry
LBP_cg2868        CDS       T02670                                 

Gene name
adhE
Definition
Bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LBP_cg2868 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBP_cg2868 (adhE)
   00620 Pyruvate metabolism
    LBP_cg2868 (adhE)
   00650 Butanoate metabolism
    LBP_cg2868 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LBP_cg2868 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LBP_cg2868 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBP_cg2868 (adhE)
   00626 Naphthalene degradation
    LBP_cg2868 (adhE)
Enzymes [BR:lpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LBP_cg2868 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LBP_cg2868 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3006826..3009534)
Genome map
AA seq 902 aa AA seqDB search
MILNNFSNSCCIMSKDGYNKVCKIIHKGIERRKHFMIKTEKNQTSKVTDEVDQLVQRSKK
ALAILKSYTQAQIDDLCEKVAVAALDNHMKLAKLAVEETGRGVVEDKAIKNIYASEYIWN
SMRHDKTVGVIKEDDEEQLMEIAEPVGIVAGVTPVTNPTSTTVFKTLISLKGRNTIVFGF
HPQAQKCSSAAADVMREAIKAAGGPADAVLYIEHPSIEATDALMHHTDVATILATGGPSM
VTAAYSSGKPALGVGPGNGPTYVEKTADIKQAVNDIVLSKTFDNGMICASENSAIIDKEI
YAEVKAEFIRLGCYYVKPKDVQALSDAVIDPNRHTVRGPVAGKTAYQIAQMAGLKDVAKD
CRVLIAEINGVGIKYPLSGEKLSPVLTVYKADSHEAAFKRANELLHYGGLGHTAGIHTTD
DALVKEFGLQMPACRILVNTPSSVGGLGNIYNNMAPSLTLGTGSYGGNSISHNVTDMDLI
NIKTVAKRRNNMQWVKMPPKVYFERNSVRYLEHMAGIKKVFLVCDPGMVEFGYADRVTAV
LNKRTDPVDIDIFSEVEPNPSTDTVYKGVARMKAFKPDTIIALGGGSAMDAAKGMWLFYE
HPEASFLGAKQKFLDIRKRTYKVPVSEKVTYIGIPTTSGTGSEVTPYAVITDSKTHVKYP
ITDYAMQPDIAIVDPQFVETVPKRTTAWTGLDVITHATEAYVSTMASDFTRGWSIQALQL
AFKYLKASYDGDKMAREKMHNASTLAGMAFANAFLGINHSIAHKLGGEFNLPHGLAIAIT
YPQVVRYNAEIPTKLAMWPKYNHNTALADYANIARALGLPGKTDEELKESLVKAYIDLAH
SMDVTLSLKANRVEKKHFDATVDELAELAYEDQCTTANPREPLISELKAIIEREWDGQGT
EK
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaataatttttcaaattcttgttgcattatgagcaaggatggctataataaa
gtttgtaaaataattcacaaaggaattgaacggaggaagcacttcatgattaagacagaa
aaaaatcaaacaagcaaagttactgacgaagttgatcaattagttcaacgttctaagaaa
gcattagctattttgaagtcatatacccaagcacaaatcgatgatttatgtgaaaaggtt
gcggttgccgcactggacaatcatatgaagttagccaagttggcggttgaggaaaccggt
cggggtgttgttgaagataaggcgattaagaacatctacgccagcgaatatatctggaac
agcatgcgccatgataagacagtcggcgtcattaaagaagacgatgaagagcaactaatg
gaaattgctgaaccagttggtatcgtagccggggttacacccgtaacgaatccaacttca
acaacggttttcaagacgttgatctcattaaaggggcgtaacacgatcgtctttggtttc
catcctcaagctcagaaatgtagttctgcggctgctgatgtgatgcgggaagcgattaaa
gctgctggtggtccagctgatgctgttttatacatcgaacacccaagcattgaagcaacc
gacgccttgatgcaccatacggatgttgcgacgatcttggctaccggtggtccaagtatg
gtgacagccgcttactcatcaggtaaaccagcactgggtgttggtcctggtaacggccca
acttatgttgaaaaaacagctgacattaagcaggcggttaacgacattgttttatcgaag
acgtttgataatgggatgatttgtgcttctgaaaatagtgccattatcgacaaggaaatt
tatgctgaagttaaagctgaatttattcgtttgggttgctactacgttaaacctaaagat
gtgcaagccttgagtgatgctgtcattgatcctaaccggcacacagttcgtggtccagtt
gctggtaaaacagcttatcaaatcgcacaaatggctggcttgaaagatgtcgctaaggac
tgccgggtcttgattgcggagattaatggtgtcggtatcaagtacccattatccggcgaa
aaattatcaccagttctgaccgtttacaaagcggattcgcatgaagcggcgttcaaacgg
gctaatgaattacttcactatggtggcttaggccatactgctgggattcatacgaccgat
gatgcattggtcaaagaatttggcttacaaatgccagcttgccggatcttagttaacacg
ccatcttcagttggtgggttaggtaacatctacaataacatggcgccttcattaactctg
ggcacgggatcatatggtggcaactcgatttctcataacgttacagatatggatctgatt
aatatcaaaactgtggcaaaacggcgtaataacatgcaatgggtcaaaatgcctcccaaa
gtctacttcgaacgcaattccgttcgctacttggaacacatggccgggattaagaaggtt
ttcctagtttgtgatcctgggatggttgaatttggctatgctgatcgagtaacggcggtc
ttgaacaagcggactgatccggttgatatcgacatcttctcagaagttgaaccgaacccg
tcgactgacacagtctacaaaggggttgcccggatgaaggcctttaagccagatacaatc
attgcactcggtggtggttctgcaatggacgccgctaaggggatgtggctcttctatgaa
cacccagaagcttccttcttaggtgctaaacagaagttcctggatatccggaagcggacg
tacaaagtaccagtatctgaaaaagtaacttatattgggattccaacgacttctgggact
ggttctgaagtaacgccatacgcggttattacggactccaagacgcacgtcaaatacccg
attacggactacgcaatgcaaccagatattgcgatcgttgacccacaatttgttgaaacg
gtgccaaagcggacgacggcttggactggtctcgacgtaattacccacgcaaccgaagca
tatgtttcaacgatggcttctgacttcacacgcggctggtcaattcaagctttgcaatta
gccttcaagtacttgaaagcttcttatgatggtgacaagatggctcgtgagaagatgcac
aatgcctcaacgctagctgggatggcctttgccaatgccttcttgggtatcaaccactcg
atcgcccataaattaggcggggaattcaacttaccacacggattggcaattgcgatcacg
tatccgcaagtcgttcgttacaatgctgaaatcccaacgaagttagcaatgtggccgaag
tacaaccataatactgccttagccgactatgccaacattgcccgggccttagggttacca
ggcaagaccgacgaagaactcaaagaaagcttagttaaagcttacattgacttggctcac
tcaatggatgtgaccttatccttgaaagccaaccgggtcgaaaagaagcactttgacgcc
accgtcgacgaattagccgaactggcctatgaagaccaatgcacgaccgctaacccacgc
gaacctttaatcagtgaattaaaggcgattattgaacgtgaatgggacggccaaggtact
gaaaaatag

DBGET integrated database retrieval system