KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0014Help
Entry
LPST_C0014        CDS       T01324                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LPST_C0014 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LPST_C0014 (proB)
Enzymes [BR:lps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LPST_C0014 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16629..17435
Genome map
AA seq 268 aa AA seqDB search
MAVVKVIRKLKAKRVVIKVGTSTLVYPDGSINLRAIDQLAFVISAMRHRGREVVLVSSGA
IGVGLNYMGLKQRPKAIPEQQAIAAIGQTELISIYKERFAIYEQKIGQLLLTRDIFVYPK
SHHNVLNTFEALLKQNVVPIVNENDTVAVDELDHETKFGDNDQLSAIVATNIGADLLIML
SDIDGFYDGNPNADARAQLLGHIEKVDQHTYKLAGGSGSRFGTGGMVTKLKAAERMIDAN
GQMILANGADPTIIFQILAGEPVGTLFG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtagtgaaagtgatacgaaaactaaaggctaaacgagtcgtgattaaagtcggg
acaagcacgctagtttatccagatggatcgatcaacttacgggcaatcgatcaattagcc
tttgtcattagcgcaatgcgacaccgtgggcgtgaagttgtcttggtttcgtcaggggct
attggtgttggcttgaattatatgggactcaagcaacgtccaaaagcaattcctgaacaa
caggcgattgcggcgattgggcaaactgaattgatttcgatttacaaagaacgtttcgcc
atttatgaacaaaaaattggccagttgttattaacacgtgatatctttgtttatcctaag
agtcaccataatgtgttgaatacatttgaggcgctattaaaacaaaacgtggtcccaatt
gttaatgaaaatgatacggtcgcggtcgatgaattggatcatgaaacaaagttcggtgat
aacgatcaactatccgcaatcgtggccacgaatatcggggcggatttgttaatcatgcta
tccgacatcgatggcttttatgatggtaatcccaatgcggatgcccgagcccagttatta
gggcacattgagaaggttgatcaacatacttataagctagctggcggtagtggcagtcgg
tttggtactggtgggatggtcactaagctaaaagcggcagaacggatgatcgatgcgaat
ggtcaaatgattttagccaatggtgcggatcccacaattatttttcaaattttagcaggc
gaaccagtcggaacgctattcggttaa

DBGET integrated database retrieval system