KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0180Help
Entry
LPST_C0180        CDS       T01324                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lps00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lps00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
201359..201844
Genome map
AA seq 161 aa AA seqDB search
MAESVYDFTETEMSGAPLDLSQYRGQVLLIVNTASNCGLAPQFKGLEELYQKYQQEGLVV
LGLPSNQFHQEKADDDETHDYCQRHYGVTFPMTKRVMVNGDDADPLFTYLKQAAGHGRIK
WNFTKFLIGRDGRVLERYAPTTRPATFEAAIRDALADRSED
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcagtgtatgattttacagaaactgagatgagtggtgcgccacttgacttg
tcacaatatcgcggtcaggtcttgctaatcgtgaatacggctagcaactgtggcctggcg
ccacagtttaaaggattagaagaactttatcagaagtatcagcaggagggcctagtggtc
ttgggattgccatccaatcaatttcatcaagaaaaggcggatgacgatgagacccatgac
tattgtcaacggcactacggggtaacgtttcccatgaccaaacgggtgatggttaatggt
gatgacgctgatccgttatttacttacctcaaacaggcggcgggacatggtcgaatcaag
tggaatttcacaaaattcctgattggtcgtgatggccgtgtgctcgaacgctatgcccca
acgacacggccggcaacatttgaagcagcgattcgtgatgccttggctgatcgttcagaa
gattaa

DBGET integrated database retrieval system