KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0414Help
Entry
LPST_C0414        CDS       T01324                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lps00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lps00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
432259..433539
Genome map
AA seq 426 aa AA seqDB search
MKKMIIHGGKRLSGELTIGGAKNSTVALIPAAILADTPVQFDTVPHILDVHNLRLILESM
NVHSTFENDVLTIDPTNIEESELPSHAIKSLRASYYFMGALLGRFNRATVTFPGGDNIGP
RPIDQHIKGFKALGANVVEENDSVFISTGTEGLHGARIFLDVVSVGATINIILAAVKAHG
TTTIENAAKEPEIIDLATFLNNMGAKIRGAGTDVIRIEGVPALHSRATHTIIPDRIETGT
YLSLAASIGDGILLKNVIPEHMESFTAKLVEMGVDLQINEDSIYVPRSNDLDPIRVKTMT
YPGFATDLQQPITPLLLRANGSSVVIDTIYPQRTQHVEQLRKMGADIRVQDNLIVVGHSS
HLQGAHVEAGEIRSGAALMIAGLAASGVTEISRADNILRGYDRVIDKLHTLGADVEIAAD
EEVPEN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgataatccatggcggaaaacgactttctggggaattaacgatcggtggc
gcaaaaaatagtaccgtcgcactgattcctgctgcgattcttgcagacactccggtccaa
ttcgatacggttccgcacatcttagacgttcacaacttacggctcatcttagagtcgatg
aacgtccattccacttttgaaaacgatgttctaacaattgatccaacaaatattgaagaa
tctgaattaccaagtcatgccattaaaagcttgcgggcttcttactactttatgggggcc
ttactcggtcgttttaaccgtgcaacggtgactttccctggtggtgataatattggtccg
cggccaattgatcagcatatcaagggttttaaggcgctcggcgctaacgtcgttgaagag
aatgactctgtctttatctcaacgggcacagagggccttcacggagcgcgcatcttttta
gacgtggtttccgttggggcgacgatcaacattattttggctgccgtcaaagctcatggt
acgaccacgattgaaaatgcggctaaagagcctgaaatcattgatttagcgacttttttg
aataatatgggcgctaaaattcggggtgctggtaccgacgtaattcgaatcgaaggcgtt
ccggcactgcattcgcgggcaacccatacgattattcctgatcggattgagacgggaacg
tatctatccctggctgcttcgattggggacggtattttgctaaagaatgtgatccctgaa
catatggagtcattcacggcaaaactagtcgaaatgggtgtcgatttacagattaatgaa
gatagtatttacgtcccacggtccaatgatttggacccaattcgggttaaaacaatgact
tacccaggctttgccactgatttgcaacaaccaatcaccccattattattgcgtgctaac
ggtagtagcgtggtgattgatacgatttatccgcaacgcacgcaacacgttgaacagtta
cgtaagatgggggcggacattcgcgttcaagataacttgattgtcgtgggtcattcttcc
cacttacaaggtgcacatgtcgaggccggtgagattcggtctggggcggcactaatgatt
gctggtctcgcggctagtggcgttacggaaattagtcgcgctgacaatattctacgtggc
tatgatcgggtcatcgataaattgcatacacttggtgcggatgtggaaattgcagccgac
gaagaagttcccgaaaactaa

DBGET integrated database retrieval system